Citrus Sinensis ID: 035892

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10

MFANLFHLHILLHMHAGQEIVNYESPRPTMGIHRFVFVLFRQLGRQTVYAPGWRQNFSTRDFAELYNLGPPVAAVYFNCQRESGSGGRPSDDEIHTCLI

cEEEccccccccccccccEEEEccccccccccccEEEEEEEEccccccccccccccccHHHHHHHccccccEEEEEEEccccccccccccccccccccc

MFANLFHLHILLHMHAGQEIVNYESPRPTMGIHRFVFVLFRQLGRQTVYAPGWRQNFSTRDFAELYNLGPPVAAVYFNCQR*************HTCLI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFANLFHLHILLHMHAGQEIVNYESPRPTMGIHRFVFVLFRQLGRQTVYAPGWRQNFSTRDFAELYNLGPPVAAVYFNCQRESGSGGRPSDDEIHTCLI

Annotation	Function Description	Confidence Level	Reference Protein
Protein FLOWERING LOCUS T	Probable component of the mobile flower-promoting signal (floral stimulus or florigen). Promotes the transition from vegetative growth to flowering. Required for 'SEPALLATA3' (SEP3) and 'FRUITFULL' (FUL) accumulation in mature rosette leaves. Seems to acts in parallel with 'LEAFY' to induce flowering by regulating 'APETALA1'. May play a role in both the autonomous and the long-day flowering pathways.	probable	Q9SXZ2
Protein HEADING DATE 3A	Probable mobile flower-promoting signal (florigen) that moves from the leaf to the shoot apical meristem (SAM) and induces flowering. Promotes the transition from vegetative growth to flowering downstream of HD1 and EHD1 under short day (SD) conditions. Acts upstream of MADS14 and MADS15.	probable	Q93WI9

No EC number assigned to the protein, probably not an enzyme!

Template: 3AXY, chain A
Confidence level:very confident
Coverage over the Query: 3-83
View the alignment between query and template
View the model in PyMOL