Citrus Sinensis ID: 035938


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MANNKGKGGKKFKNRKRGKNNEGEDQKRELIIKEEGQEYAEVLRMLGNGRLRLHWRHQAMHKRVWIAAGDIILVGFRIYQDDKADVILINTPDEAKRLKNIGELPDGTRLNEGLLLILMMTPMLFQDNDIDKI
cccccccccccccccccccccccccccEEEEcccccEEEEEEEEEccccEEEEEEEcccccEEEEEEEccEEEEEccccccccCEEEEEccHHHHHHHHHccccccccEEcccccccccccccEECccccccc
*******************************IKEEGQEYAEVLRMLGNGRLRLHWRHQAMHKRVWIAAGDIILVGFRIYQDDKADVILINTPDEAKRLKNIGELPDGTRLNEGLLLILMMTPMLFQDNDIDK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANNKGKGGKKFKNRKRGKNNEGEDQKRELIIKEEGQEYAEVLRMLGNGRLRLHWRHQAMHKRVWIAAGDIILVGFRIYQDDKADVILINTPDEAKRLKNIGELPDGTRLNEGLLLILMMTPMLFQDNDIDKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 1A, Y-chromosomal Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.probableQ6GVM3
Eukaryotic translation initiation factor 1A, Y-chromosomal Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.probableO14602
Eukaryotic translation initiation factor 1A Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.probableP56331

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OQK, chain A
Confidence level:very confident
Coverage over the Query: 26-110
View the alignment between query and template
View the model in PyMOL
Template: 1D7Q, chain A
Confidence level:very confident
Coverage over the Query: 30-117
View the alignment between query and template
View the model in PyMOL