Citrus Sinensis ID: 035977


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MLEPLAVGGVIGDVIESFTPSIKMSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGDMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVFVLFKQTRRQTVNPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR
cccccccccEEccccccccccEEEEEEEccEEcccccECcccccccccEEEECccccccEEEEEEEcccccccccccccEEEEEEEEcccccccccccCEEEECcccccccccccEEEEEEEcccccccccccccccccHHHHHHHHcccccEEEEEEEEEEccccccc
MLEPLAVGGVIGDVIESFTPSIKMSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGDMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVFVLFKQT************HFNTRAFAAENDLGLPVAAVYFNAQR*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEPLAVGGVIGDVIESFTPSIKMSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGDMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVFVLFKQTRRQTVNPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TERMINAL FLOWER 1 Controls inflorescence meristem identity and is required for maintenance of a indeterminate inflorescence. Prevents the expression of 'APETALA1' and 'LEAFY'. Also plays a role in the regulation of the time of flowering in the long-day flowering pathway. May form complexes with phosphorylated ligands by interfering with kinases and their effectors.confidentP93003
Protein SELF-PRUNING Not known. In plants homozygous for the recessive allele of the SP gene, sympodial segments develop progressively fewer nodes until the shoot is terminated by two consecutive. inflorescences.probableO82088
Protein CENTRORADIALIS Expression of CEN leads to a morphological switch between shoot growth and the development of flower structures (inflorescence). May form complexes with phosphorylated ligands by interfering with kinases and their effectors.probableQ41261

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WKO, chain A
Confidence level:very confident
Coverage over the Query: 2-163
View the alignment between query and template
View the model in PyMOL