Citrus Sinensis ID: 036010

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----

IIVGFKNRYMVVEVFLDPDKELPMDDPVILTQFNVSKAIRDNILVNFSECGLASLLGSFQVKYVNPITKLCIIKASMEDFQKVWSAITMVRSIGNCLVLFNVLDLSGSIRACKNAALKREEVIFEHYKLAVGARFSADVTQHMDNCLEKIKILEY

ccccccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHcccEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHccEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcc

IIVGFKNRYMVVEVFLDPDKELPMDDPVILTQFNVSKAIRDNILVNFSECGLASLLGSFQVKYVNPITKLCIIKASMEDFQKVWSAITMVRSIGNCLVLFNVLDLSGSIRACKNAALKREEVIFEHYKLAVGARFSADVTQHMDNCLEKIKIL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

IIVGFKNRYMVVEVFLDPDKELPMDDPVILTQFNVSKAIRDNILVNFSECGLASLLGSFQVKYVNPITKLCIIKASMEDFQKVWSAITMVRSIGNCLVLFNVLDLSGSIRACKNAALKREEVIFEHYKLAVGARFSADVTQHMDNCLEKIKILEY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable ribonuclease P/MRP protein subunit POP5	Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP.	probable	Q6AWV1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CZV, chain C
Confidence level:very confident
Coverage over the Query: 2-19,30-118
View the alignment between query and template
View the model in PyMOL