Citrus Sinensis ID: 036026

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--

MSKSVEGVLAEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSNFDSKHPTLPPKLALLKEKPIVSGDSSDQSHDDRAAESQTISKMKFSQIEKRPPRVFRPPPKPSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGSLPRGVGSGDKVQRAPELVEFYQTLMKREAKKDTSSLISSTSNTSDARSNMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVHKQTVEDNKQEA

ccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHccccHHcccc

**********EKYPAYKDRHKL******************************************************************************************************************************************************ELVEFY*************************************SFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMK******************EFLLLQGVRFAFRVHQFAGGFDAESMKAFEVL****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSKSVEGVLAEKYPAYxxxxxxxxxxxxxxxxxxxxxRAYRFRDNSNFDSKHPTLPPKLALLKEKPIVSGDSSDQSHDDRAAESQTISKMKFSQIEKRPPRVFRPPPKPSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGSLPRGVGSGDKVQRAPELVEFYQTLMKREAKKDTSSLISSTSNTSDARSNMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVHKQTVEDNKQEA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein CHUP1, chloroplastic	Required for the positioning and movement of chloroplasts. Interacts with profilin and actin independent of its polymerization status. Regulates chloroplast localization by anchoring chloroplasts to the plasma membrane and forming a bridge to the actin cytoskeleton.	probable	Q9LI74

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z73, chain A
Confidence level:probable
Coverage over the Query: 54-83
View the alignment between query and template
View the model in PyMOL

Template: 1DEQ, chain A
Confidence level:probable
Coverage over the Query: 27-78
View the alignment between query and template
View the model in PyMOL

Template: 2B5L, chain C
Confidence level:probable
Coverage over the Query: 140-191
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1m2v, chain B		probable	Alignment \| Template Structure