Citrus Sinensis ID: 036026


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--
MSKSVEGVLAEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSNFDSKHPTLPPKLALLKEKPIVSGDSSDQSHDDRAAESQTISKMKFSQIEKRPPRVFRPPPKPSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGSLPRGVGSGDKVQRAPELVEFYQTLMKREAKKDTSSLISSTSNTSDARSNMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVHKQTVEDNKQEA
ccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHcccHHHHccc
ccccccccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccc
MSKSVEGVlaekypaykDRHKLALEREKQIKEKAEKARAyrfrdnsnfdskhptlppklallkekpivsgdssdqshddraaESQTISKMKFSqiekrpprvfrpppkpsggapagtnanpssgtppapppppgatpppppppppggppppppppgslprgvgsgdkvqraPELVEFYQTLMKREAKKDTSSlisstsntsdarSNMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVlkhfdwpegkADALREAAFEYQDLVKLEKQVssfvddpglpcESALKKMYKLLEKVEQSVYALLRTRDMAISRYRefgipvdwlldtgvvgkIKLSSVQLARKYMKRVSTELeamsrpekepnrEFLLLQGVRFAFRVhqfaggfdaeSMKAFEVLRSRVHKQTvednkqea
msksvegvlaekypaykdrhklALEREKQIKEKAEKArayrfrdnsnfdskhptlpPKLALLKEKPIvsgdssdqshddraaesqtiskmkfsqiekrpprvfrpppkpSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGSLPRGVGSGDKVQRAPELVEFYQTLMkreakkdtsslisstsntsdarsnMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTeleamsrpekepnrEFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSrvhkqtvednkqea
MSKSVEGVLAEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSNFDSkhptlppklallkekpIVSGDSSDQSHDDRAAESQTISKMKFSQIEkrpprvfrpppkpsggapagTNANpssgtppapppppgatpppppppppggppppppppgSLPRGVGSGDKVQRAPELVEFYQTLMKREAKKDtsslisstsntsDARSNMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVHKQTVEDNKQEA
***********************************************************************************************************************************************************************************************************************SFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMK******************EFLLLQGVRFAFRVHQFAGGFDAESMKAFEVL****************
**********EKYPAYKDRHKL******************************************************************************************************************************************************ELVEFY**************************************FLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYAL**********YREFGIPVDWLLDTGVVGKIKLSSVQLARKYM*********************LLLQGVRFAFRVHQFAGGFDAESMKAFEV*****************
MSKSVEGVLAEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSNFDSKHPTLPPKLALLKEKPI******************TISKMKFSQIEKRPPRVFRPPP*********************************************PPPGSLPRGVGSGDKVQRAPELVEFYQTLMKR*******************RSNMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVS***********EPNREFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVH***********
*******VLAEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRD********PTLPPK*****E*******************SQTISKMKFSQIEKRPPRVFR****************************PGATPPPP*******************************PE*********K**********************NMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVH***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKSVEGVLAEKYPAYxxxxxxxxxxxxxxxxxxxxxRAYRFRDNSNFDSKHPTLPPKLALLKEKPIVSGDSSDQSHDDRAAESQTISKMKFSQIEKRPPRVFRPPPKPSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGSLPRGVGSGDKVQRAPELVEFYQTLMKREAKKDTSSLISSTSNTSDARSNMIGEIENKSSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVHKQTVEDNKQEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query442 2.2.26 [Sep-21-2011]
Q9LI741004 Protein CHUP1, chloroplas yes no 0.961 0.423 0.722 1e-152
>sp|Q9LI74|CHUP1_ARATH Protein CHUP1, chloroplastic OS=Arabidopsis thaliana GN=CHUP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  538 bits (1385), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 325/450 (72%), Positives = 370/450 (82%), Gaps = 25/450 (5%)

Query: 1   MSKSVEGVLAEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSNFDSKHPTLPPKLA 60
           MSKSV+ VL EKYPAYKDRHKLA+EREK IK KA++ARA RF  N         LPPKLA
Sbjct: 546 MSKSVDNVLDEKYPAYKDRHKLAVEREKHIKHKADQARAERFGGN-------VALPPKLA 598

Query: 61  LLKEKPIV-------SGDSSDQSHDD---RAAESQ-TISKMKFSQIEKRPPRVFRPPPKP 109
            LKEK +V       +GD S++S++    +A+E+  T++KMK   IEKRPPRV RPPP+ 
Sbjct: 599 QLKEKRVVVPSVITATGDQSNESNESNEGKASENAATVTKMKLVDIEKRPPRVPRPPPRS 658

Query: 110 SGGAPAGTNANPSS---GTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGSLPRGVGSGD 166
           +GG  + TN  PS+        PPPPP      PPPPP GGPPPPPPPPG+L RG G G+
Sbjct: 659 AGGGKS-TNL-PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGGN 716

Query: 167 KVQRAPELVEFYQTLMKREAKKDTS-SLISS-TSNTSDARSNMIGEIENKSSFLLAVKAD 224
           KV RAPELVEFYQ+LMKRE+KK+ + SLISS T N+S AR+NMIGEIEN+S+FLLAVKAD
Sbjct: 717 KVHRAPELVEFYQSLMKRESKKEGAPSLISSGTGNSSAARNNMIGEIENRSTFLLAVKAD 776

Query: 225 VETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADAL 284
           VETQGDFVQSLA EVRA+SFT +EDL+ FV+WLDEELSFLVDERAVLKHFDWPEGKADAL
Sbjct: 777 VETQGDFVQSLATEVRASSFTDIEDLLAFVSWLDEELSFLVDERAVLKHFDWPEGKADAL 836

Query: 285 REAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRY 344
           REAAFEYQDL+KLEKQV+SFVDDP L CE ALKKMYKLLEKVEQSVYALLRTRDMAISRY
Sbjct: 837 REAAFEYQDLMKLEKQVTSFVDDPNLSCEPALKKMYKLLEKVEQSVYALLRTRDMAISRY 896

Query: 345 REFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRF 404
           +EFGIPVDWL DTGVVGKIKLSSVQLA+KYMKRV+ EL+++S  +K+PNREFLLLQGVRF
Sbjct: 897 KEFGIPVDWLSDTGVVGKIKLSSVQLAKKYMKRVAYELDSVSGSDKDPNREFLLLQGVRF 956

Query: 405 AFRVHQFAGGFDAESMKAFEVLRSRVHKQT 434
           AFRVHQFAGGFDAESMKAFE LRSR   ++
Sbjct: 957 AFRVHQFAGGFDAESMKAFEELRSRAKTES 986




Required for the positioning and movement of chloroplasts. Interacts with profilin and actin independent of its polymerization status. Regulates chloroplast localization by anchoring chloroplasts to the plasma membrane and forming a bridge to the actin cytoskeleton.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query442
255566821 998 conserved hypothetical protein [Ricinus 0.986 0.436 0.811 0.0
359472709 1003 PREDICTED: protein CHUP1, chloroplastic- 0.990 0.436 0.826 0.0
297737876 969 unnamed protein product [Vitis vinifera] 0.990 0.452 0.826 0.0
224111748 955 predicted protein [Populus trichocarpa] 0.972 0.450 0.778 1e-177
449493474 987 PREDICTED: protein CHUP1, chloroplastic- 0.995 0.445 0.746 1e-172
449434670 987 PREDICTED: protein CHUP1, chloroplastic- 0.995 0.445 0.746 1e-172
356498346 955 PREDICTED: protein CHUP1, chloroplastic- 0.981 0.454 0.763 1e-170
357488243 997 Protein CHUP1 [Medicago truncatula] gi|3 0.975 0.432 0.746 1e-168
356502487 964 PREDICTED: protein CHUP1, chloroplastic- 0.981 0.450 0.758 1e-165
356576275 973 PREDICTED: protein CHUP1, chloroplastic- 0.959 0.435 0.729 1e-165
>gi|255566821|ref|XP_002524394.1| conserved hypothetical protein [Ricinus communis] gi|223536355|gb|EEF38005.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/446 (81%), Positives = 396/446 (88%), Gaps = 10/446 (2%)

Query: 1   MSKSVEGVLAEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSNFDS-------KHP 53
           MSKSVEGVL EKYPAYKDRHKLALEREKQIKE+AEKARA RF +NS+F S       K  
Sbjct: 552 MSKSVEGVLDEKYPAYKDRHKLALEREKQIKERAEKARAARFGENSSFQSIAKGGREKAV 611

Query: 54  TLPPKLALLKEKPIVSGDSSDQSHDDRAAESQTISKMKFSQIEKRPPRVFRPPPKPSGGA 113
           +LP +LA +KEKP+ SGDS+DQS++ +A +SQTISKMK +QIEKRP RV RPPPKPSGGA
Sbjct: 612 SLPSQLAQIKEKPVDSGDSNDQSNEGKAVDSQTISKMKLTQIEKRPTRVPRPPPKPSGGA 671

Query: 114 PAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGSLPRGVGSGDKVQRAPE 173
           PA TN   S+ +   PPPPP     P PPPPPGGPP PPPPPGSLPRG GSGDKV RAPE
Sbjct: 672 PADTN---STPSSGLPPPPPPPPGIPAPPPPPGGPPRPPPPPGSLPRGAGSGDKVHRAPE 728

Query: 174 LVEFYQTLMKREAKKDTSSLISSTSNTSDARSNMIGEIENKSSFLLAVKADVETQGDFVQ 233
           LVEFYQ+LMKREAKKDTSSLISSTSN S+ARSNMIGEIEN+SSFLLAVKADVE+QG+FVQ
Sbjct: 729 LVEFYQSLMKREAKKDTSSLISSTSNASEARSNMIGEIENRSSFLLAVKADVESQGEFVQ 788

Query: 234 SLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQD 293
           SLA EVRA+SFT +EDL+ FVNWLDEELSFLVDERAVLKHFDWPE KADALREAAFEYQD
Sbjct: 789 SLATEVRASSFTNIEDLLAFVNWLDEELSFLVDERAVLKHFDWPESKADALREAAFEYQD 848

Query: 294 LVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDW 353
           L+KLEKQVSSFVDDP LPCE+ALKKMYKLLEKVE SVYALLRTRDMAISRYREFGIP++W
Sbjct: 849 LMKLEKQVSSFVDDPNLPCEAALKKMYKLLEKVENSVYALLRTRDMAISRYREFGIPINW 908

Query: 354 LLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRFAFRVHQFAG 413
           LLD+GVVGKIKLSSVQLA+KYMKRV++EL+AMS PEKEPNREFLLLQGVRFAFRVHQFAG
Sbjct: 909 LLDSGVVGKIKLSSVQLAKKYMKRVASELDAMSGPEKEPNREFLLLQGVRFAFRVHQFAG 968

Query: 414 GFDAESMKAFEVLRSRVHKQTVEDNK 439
           GFDAESMK FE LRSRVH Q VE+N+
Sbjct: 969 GFDAESMKTFEELRSRVHGQMVEENR 994




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359472709|ref|XP_002281154.2| PREDICTED: protein CHUP1, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737876|emb|CBI27077.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111748|ref|XP_002315963.1| predicted protein [Populus trichocarpa] gi|222865003|gb|EEF02134.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449493474|ref|XP_004159306.1| PREDICTED: protein CHUP1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449434670|ref|XP_004135119.1| PREDICTED: protein CHUP1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356498346|ref|XP_003518014.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357488243|ref|XP_003614409.1| Protein CHUP1 [Medicago truncatula] gi|355515744|gb|AES97367.1| Protein CHUP1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356502487|ref|XP_003520050.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356576275|ref|XP_003556258.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query442
TAIR|locus:21023851004 CHUP1 "CHLOROPLAST UNUSUAL POS 0.638 0.280 0.788 3.7e-133
TAIR|locus:2831359642 AT4G18570 [Arabidopsis thalian 0.615 0.423 0.567 5e-76
TAIR|locus:2007755558 AT1G48280 "AT1G48280" [Arabido 0.615 0.487 0.454 2.3e-64
TAIR|locus:2007477392 AT1G07120 "AT1G07120" [Arabido 0.576 0.650 0.463 2.5e-56
TAIR|locus:2102385 CHUP1 "CHLOROPLAST UNUSUAL POSITIONING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1131 (403.2 bits), Expect = 3.7e-133, Sum P(2) = 3.7e-133
 Identities = 224/284 (78%), Positives = 250/284 (88%)

Query:   157 SLPRGVGSGDKVQRAPELVEFYQTLMKREAKKDXXXXXXXXXXXXD--ARSNMIGEIENK 214
             +L RG G G+KV RAPELVEFYQ+LMKRE+KK+               AR+NMIGEIEN+
Sbjct:   707 ALGRGAGGGNKVHRAPELVEFYQSLMKRESKKEGAPSLISSGTGNSSAARNNMIGEIENR 766

Query:   215 SSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHF 274
             S+FLLAVKADVETQGDFVQSLA EVRA+SFT +EDL+ FV+WLDEELSFLVDERAVLKHF
Sbjct:   767 STFLLAVKADVETQGDFVQSLATEVRASSFTDIEDLLAFVSWLDEELSFLVDERAVLKHF 826

Query:   275 DWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALL 334
             DWPEGKADALREAAFEYQDL+KLEKQV+SFVDDP L CE ALKKMYKLLEKVEQSVYALL
Sbjct:   827 DWPEGKADALREAAFEYQDLMKLEKQVTSFVDDPNLSCEPALKKMYKLLEKVEQSVYALL 886

Query:   335 RTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNR 394
             RTRDMAISRY+EFGIPVDWL DTGVVGKIKLSSVQLA+KYMKRV+ EL+++S  +K+PNR
Sbjct:   887 RTRDMAISRYKEFGIPVDWLSDTGVVGKIKLSSVQLAKKYMKRVAYELDSVSGSDKDPNR 946

Query:   395 EFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVHKQTVEDN 438
             EFLLLQGVRFAFRVHQFAGGFDAESMKAFE LRSR   ++ ++N
Sbjct:   947 EFLLLQGVRFAFRVHQFAGGFDAESMKAFEELRSRAKTESGDNN 990


GO:0005634 "nucleus" evidence=ISM
GO:0009507 "chloroplast" evidence=IDA
GO:0009707 "chloroplast outer membrane" evidence=IDA
GO:0009902 "chloroplast relocation" evidence=RCA;IMP
GO:0006364 "rRNA processing" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2831359 AT4G18570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007755 AT1G48280 "AT1G48280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007477 AT1G07120 "AT1G07120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LI74CHUP1_ARATHNo assigned EC number0.72220.96150.4233yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00030273001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (959 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00002921001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (825 aa)
      0.413

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query442
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 8e-09
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 2e-08
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 3e-08
PRK12438991 PRK12438, PRK12438, hypothetical protein; Provisio 2e-07
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 3e-07
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 3e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 5e-07
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 8e-07
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 9e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 1e-06
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 2e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 2e-06
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-06
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 3e-06
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 5e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 5e-06
pfam04652315 pfam04652, DUF605, Vta1 like 6e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 8e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-05
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 2e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-05
PHA03291401 PHA03291, PHA03291, envelope glycoprotein I; Provi 2e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 4e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 4e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 4e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-05
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 5e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 5e-05
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 5e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 6e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 6e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-05
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 6e-05
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 6e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 7e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 7e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 7e-05
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 7e-05
pfam12526115 pfam12526, DUF3729, Protein of unknown function (D 7e-05
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 8e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 9e-05
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 9e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-04
PRK13729475 PRK13729, PRK13729, conjugal transfer pilus assemb 1e-04
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 1e-04
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 1e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-04
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 2e-04
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 2e-04
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 2e-04
pfam04652315 pfam04652, DUF605, Vta1 like 2e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-04
pfam07415 489 pfam07415, Herpes_LMP2, Gammaherpesvirus latent me 2e-04
pfam10349111 pfam10349, WWbp, WW-domain ligand protein 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-04
pfam06682317 pfam06682, DUF1183, Protein of unknown function (D 3e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-04
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 4e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 4e-04
pfam04652315 pfam04652, DUF605, Vta1 like 4e-04
PRK13406584 PRK13406, bchD, magnesium chelatase subunit D; Pro 4e-04
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 4e-04
pfam06003264 pfam06003, SMN, Survival motor neuron protein (SMN 4e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 5e-04
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 5e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 6e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-04
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 6e-04
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 6e-04
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 6e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 7e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-04
PHA03291401 PHA03291, PHA03291, envelope glycoprotein I; Provi 8e-04
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 8e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 9e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-04
pfam04652315 pfam04652, DUF605, Vta1 like 9e-04
pfam06682317 pfam06682, DUF1183, Protein of unknown function (D 9e-04
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 9e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.001
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.001
pfam10349111 pfam10349, WWbp, WW-domain ligand protein 0.001
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 0.001
pfam12238201 pfam12238, MSA-2c, Merozoite surface antigen 2c 0.001
pfam01213313 pfam01213, CAP_N, Adenylate cyclase associated (CA 0.001
pfam09606768 pfam09606, Med15, ARC105 or Med15 subunit of Media 0.001
PRK097521250 PRK09752, PRK09752, adhesin; Provisional 0.001
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.001
PRK14952584 PRK14952, PRK14952, DNA polymerase III subunits ga 0.001
pfam12868135 pfam12868, DUF3824, Domain of unknwon function (DU 0.001
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
pfam04652315 pfam04652, DUF605, Vta1 like 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.002
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.002
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.002
TIGR00601378 TIGR00601, rad23, UV excision repair protein Rad23 0.002
pfam06070777 pfam06070, Herpes_UL32, Herpesvirus large structur 0.002
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 0.002
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.002
PRK03100136 PRK03100, PRK03100, sec-independent translocase; P 0.002
pfam0483497 pfam04834, Adeno_E3_14_5, Early E3 14 0.002
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 0.003
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.003
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.003
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.003
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.003
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 0.003
pfam1013898 pfam10138, Tellurium_res, Tellurium resistance pro 0.003
PRK06975656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 0.003
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.003
pfam09849234 pfam09849, DUF2076, Uncharacterized protein conser 0.003
PRK09429275 PRK09429, mepA, penicillin-insensitive murein endo 0.003
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 0.003
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.004
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.004
pfam12868135 pfam12868, DUF3824, Domain of unknwon function (DU 0.004
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.004
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.004
PHA0173294 PHA01732, PHA01732, proline-rich protein 0.004
PRK11892464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 0.004
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
 Score = 56.1 bits (135), Expect = 8e-09
 Identities = 27/67 (40%), Positives = 28/67 (41%), Gaps = 2/67 (2%)

Query: 99  PPRVFRPPPKPSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPP--PGGPPPPPPPPG 156
                  P  P    P      P    P A PPPP A P  PPPPP  P  PPPP P PG
Sbjct: 50  TAAAAPAPAAPPPPPPPAAPPAPQPDDPNAAPPPPPADPNAPPPPPVDPNAPPPPAPEPG 109

Query: 157 SLPRGVG 163
            +   VG
Sbjct: 110 RIDNAVG 116


This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix. Length = 297

>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein Back     alignment and domain information
>gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|221480 pfam12238, MSA-2c, Merozoite surface antigen 2c Back     alignment and domain information
>gnl|CDD|216368 pfam01213, CAP_N, Adenylate cyclase associated (CAP) N terminal Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|179538 PRK03100, PRK03100, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|147144 pfam04834, Adeno_E3_14_5, Early E3 14 Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|220596 pfam10138, Tellurium_res, Tellurium resistance protein Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) Back     alignment and domain information
>gnl|CDD|236511 PRK09429, mepA, penicillin-insensitive murein endopeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 442
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 99.89
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 99.19
KOG1830518 consensus Wiskott Aldrich syndrome proteins [Cytos 98.7
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 98.05
KOG1923 830 consensus Rac1 GTPase effector FRL [Signal transdu 96.9
KOG1925 817 consensus Rac1 GTPase effector FHOS [Signal transd 96.05
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 95.67
KOG1923 830 consensus Rac1 GTPase effector FRL [Signal transdu 95.27
PHA032473151 large tegument protein UL36; Provisional 94.46
PRK153192039 AIDA autotransporter-like protein ShdA; Provisiona 92.9
KOG3997281 consensus Major apurinic/apyrimidinic endonuclease 91.71
PHA0173294 proline-rich protein 90.38
KOG1922 833 consensus Rho GTPase effector BNI1 and related for 89.57
KOG4672487 consensus Uncharacterized conserved low complexity 89.3
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 84.47
KOG1830518 consensus Wiskott Aldrich syndrome proteins [Cytos 83.84
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 83.14
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 82.81
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
Probab=99.89  E-value=3.9e-23  Score=220.50  Aligned_cols=38  Identities=21%  Similarity=0.333  Sum_probs=35.5

Q ss_pred             cccCCCCccchhhhhhHHHHHHHHHHHHHHhhhccCCC
Q 036026           10 AEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSN   47 (442)
Q Consensus        10 ~~~~P~f~~r~~l~~d~~~~i~~~~~k~~~~~~~~~~~   47 (442)
                      +|+||||+||+||+||++.+||.|+||++++++++++.
T Consensus       440 ~~~DPdf~yr~~l~id~~~liD~~vdkak~eeseqkA~  477 (1102)
T KOG1924|consen  440 TGMDPDFKYRFRLDIDLTELIDKMVDKAKAEESEQKAA  477 (1102)
T ss_pred             CCCCCCcchhhcccCcHHHHHHHHHHHHHHHHHHHHHH
Confidence            68999999999999999999999999999999997653



>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>PRK15319 AIDA autotransporter-like protein ShdA; Provisional Back     alignment and domain information
>KOG3997 consensus Major apurinic/apyrimidinic endonuclease/3'-repair diesterase APN1 [Replication, recombination and repair] Back     alignment and domain information
>PHA01732 proline-rich protein Back     alignment and domain information
>KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query442
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-10
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-10
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-10
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 9e-10
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-09
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-05
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 4e-09
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 9e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 3e-08
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 5e-06
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 9e-06
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 1e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 1e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 4e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 7e-05
3q2s_C229 Cleavage and polyadenylation specificity factor S; 7e-08
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-06
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 6e-07
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 3e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 3e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 5e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 2e-06
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 2e-04
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 2e-04
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 3e-04
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 4e-06
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 7e-05
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 7e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-06
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 1e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 2e-04
1jer_A138 Cucumber stellacyanin; electron transport, copper, 4e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-05
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 1e-04
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 5e-04
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 8e-04
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 1e-04
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 2e-04
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 2e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-04
1jvr_A137 HTLV-II MA, MA, human T-cell leukemia virus type I 3e-04
2b5l_C222 Nonstructural protein V; DDB1, SV5-V, beta propell 3e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 3e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 5e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 6e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 8e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 3e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 6e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 4e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 6e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 6e-04
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 5e-04
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 5e-04
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 6e-04
4f6o_A350 Metacaspase-1; rossmann fold, hydrolase; HET: DFH; 6e-04
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
 Score = 60.0 bits (145), Expect = 2e-10
 Identities = 19/62 (30%), Positives = 20/62 (32%)

Query: 98  RPPRVFRPPPKPSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGS 157
               V       +          P     P PP   GA PP    PPPG  PP  PP G 
Sbjct: 146 GRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGI 205

Query: 158 LP 159
            P
Sbjct: 206 PP 207


>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1jvr_A HTLV-II MA, MA, human T-cell leukemia virus type II matrix protein; HTLV-II matrix protein, retroviral matrix protein; NMR {Human t-lymphotropic virus 2} SCOP: a.61.1.2 Length = 137 Back     alignment and structure
>2b5l_C Nonstructural protein V; DDB1, SV5-V, beta propeller, propeller cluster, zinc finger, protein binding/viral protein complex; 2.85A {Simian virus 5} PDB: 2hye_B* Length = 222 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Length = 388 Back     alignment and structure
>4f6o_A Metacaspase-1; rossmann fold, hydrolase; HET: DFH; 1.68A {Saccharomyces cerevisiae} Length = 350 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 442
d1jvra_137 a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell 1e-04
d1jvra_137 a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell 1e-04
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 8e-04
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 0.001
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 0.001
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 0.002

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00