Citrus Sinensis ID: 036026
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 442 | ||||||
| 255566821 | 998 | conserved hypothetical protein [Ricinus | 0.986 | 0.436 | 0.811 | 0.0 | |
| 359472709 | 1003 | PREDICTED: protein CHUP1, chloroplastic- | 0.990 | 0.436 | 0.826 | 0.0 | |
| 297737876 | 969 | unnamed protein product [Vitis vinifera] | 0.990 | 0.452 | 0.826 | 0.0 | |
| 224111748 | 955 | predicted protein [Populus trichocarpa] | 0.972 | 0.450 | 0.778 | 1e-177 | |
| 449493474 | 987 | PREDICTED: protein CHUP1, chloroplastic- | 0.995 | 0.445 | 0.746 | 1e-172 | |
| 449434670 | 987 | PREDICTED: protein CHUP1, chloroplastic- | 0.995 | 0.445 | 0.746 | 1e-172 | |
| 356498346 | 955 | PREDICTED: protein CHUP1, chloroplastic- | 0.981 | 0.454 | 0.763 | 1e-170 | |
| 357488243 | 997 | Protein CHUP1 [Medicago truncatula] gi|3 | 0.975 | 0.432 | 0.746 | 1e-168 | |
| 356502487 | 964 | PREDICTED: protein CHUP1, chloroplastic- | 0.981 | 0.450 | 0.758 | 1e-165 | |
| 356576275 | 973 | PREDICTED: protein CHUP1, chloroplastic- | 0.959 | 0.435 | 0.729 | 1e-165 |
| >gi|255566821|ref|XP_002524394.1| conserved hypothetical protein [Ricinus communis] gi|223536355|gb|EEF38005.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 647 bits (1669), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 362/446 (81%), Positives = 396/446 (88%), Gaps = 10/446 (2%)
Query: 1 MSKSVEGVLAEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSNFDS-------KHP 53
MSKSVEGVL EKYPAYKDRHKLALEREKQIKE+AEKARA RF +NS+F S K
Sbjct: 552 MSKSVEGVLDEKYPAYKDRHKLALEREKQIKERAEKARAARFGENSSFQSIAKGGREKAV 611
Query: 54 TLPPKLALLKEKPIVSGDSSDQSHDDRAAESQTISKMKFSQIEKRPPRVFRPPPKPSGGA 113
+LP +LA +KEKP+ SGDS+DQS++ +A +SQTISKMK +QIEKRP RV RPPPKPSGGA
Sbjct: 612 SLPSQLAQIKEKPVDSGDSNDQSNEGKAVDSQTISKMKLTQIEKRPTRVPRPPPKPSGGA 671
Query: 114 PAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGSLPRGVGSGDKVQRAPE 173
PA TN S+ + PPPPP P PPPPPGGPP PPPPPGSLPRG GSGDKV RAPE
Sbjct: 672 PADTN---STPSSGLPPPPPPPPGIPAPPPPPGGPPRPPPPPGSLPRGAGSGDKVHRAPE 728
Query: 174 LVEFYQTLMKREAKKDTSSLISSTSNTSDARSNMIGEIENKSSFLLAVKADVETQGDFVQ 233
LVEFYQ+LMKREAKKDTSSLISSTSN S+ARSNMIGEIEN+SSFLLAVKADVE+QG+FVQ
Sbjct: 729 LVEFYQSLMKREAKKDTSSLISSTSNASEARSNMIGEIENRSSFLLAVKADVESQGEFVQ 788
Query: 234 SLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHFDWPEGKADALREAAFEYQD 293
SLA EVRA+SFT +EDL+ FVNWLDEELSFLVDERAVLKHFDWPE KADALREAAFEYQD
Sbjct: 789 SLATEVRASSFTNIEDLLAFVNWLDEELSFLVDERAVLKHFDWPESKADALREAAFEYQD 848
Query: 294 LVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDW 353
L+KLEKQVSSFVDDP LPCE+ALKKMYKLLEKVE SVYALLRTRDMAISRYREFGIP++W
Sbjct: 849 LMKLEKQVSSFVDDPNLPCEAALKKMYKLLEKVENSVYALLRTRDMAISRYREFGIPINW 908
Query: 354 LLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNREFLLLQGVRFAFRVHQFAG 413
LLD+GVVGKIKLSSVQLA+KYMKRV++EL+AMS PEKEPNREFLLLQGVRFAFRVHQFAG
Sbjct: 909 LLDSGVVGKIKLSSVQLAKKYMKRVASELDAMSGPEKEPNREFLLLQGVRFAFRVHQFAG 968
Query: 414 GFDAESMKAFEVLRSRVHKQTVEDNK 439
GFDAESMK FE LRSRVH Q VE+N+
Sbjct: 969 GFDAESMKTFEELRSRVHGQMVEENR 994
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359472709|ref|XP_002281154.2| PREDICTED: protein CHUP1, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737876|emb|CBI27077.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224111748|ref|XP_002315963.1| predicted protein [Populus trichocarpa] gi|222865003|gb|EEF02134.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449493474|ref|XP_004159306.1| PREDICTED: protein CHUP1, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449434670|ref|XP_004135119.1| PREDICTED: protein CHUP1, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356498346|ref|XP_003518014.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357488243|ref|XP_003614409.1| Protein CHUP1 [Medicago truncatula] gi|355515744|gb|AES97367.1| Protein CHUP1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356502487|ref|XP_003520050.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356576275|ref|XP_003556258.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 442 | ||||||
| TAIR|locus:2102385 | 1004 | CHUP1 "CHLOROPLAST UNUSUAL POS | 0.638 | 0.280 | 0.788 | 3.7e-133 | |
| TAIR|locus:2831359 | 642 | AT4G18570 [Arabidopsis thalian | 0.615 | 0.423 | 0.567 | 5e-76 | |
| TAIR|locus:2007755 | 558 | AT1G48280 "AT1G48280" [Arabido | 0.615 | 0.487 | 0.454 | 2.3e-64 | |
| TAIR|locus:2007477 | 392 | AT1G07120 "AT1G07120" [Arabido | 0.576 | 0.650 | 0.463 | 2.5e-56 |
| TAIR|locus:2102385 CHUP1 "CHLOROPLAST UNUSUAL POSITIONING 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1131 (403.2 bits), Expect = 3.7e-133, Sum P(2) = 3.7e-133
Identities = 224/284 (78%), Positives = 250/284 (88%)
Query: 157 SLPRGVGSGDKVQRAPELVEFYQTLMKREAKKDXXXXXXXXXXXXD--ARSNMIGEIENK 214
+L RG G G+KV RAPELVEFYQ+LMKRE+KK+ AR+NMIGEIEN+
Sbjct: 707 ALGRGAGGGNKVHRAPELVEFYQSLMKRESKKEGAPSLISSGTGNSSAARNNMIGEIENR 766
Query: 215 SSFLLAVKADVETQGDFVQSLAAEVRAASFTTVEDLVVFVNWLDEELSFLVDERAVLKHF 274
S+FLLAVKADVETQGDFVQSLA EVRA+SFT +EDL+ FV+WLDEELSFLVDERAVLKHF
Sbjct: 767 STFLLAVKADVETQGDFVQSLATEVRASSFTDIEDLLAFVSWLDEELSFLVDERAVLKHF 826
Query: 275 DWPEGKADALREAAFEYQDLVKLEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALL 334
DWPEGKADALREAAFEYQDL+KLEKQV+SFVDDP L CE ALKKMYKLLEKVEQSVYALL
Sbjct: 827 DWPEGKADALREAAFEYQDLMKLEKQVTSFVDDPNLSCEPALKKMYKLLEKVEQSVYALL 886
Query: 335 RTRDMAISRYREFGIPVDWLLDTGVVGKIKLSSVQLARKYMKRVSTELEAMSRPEKEPNR 394
RTRDMAISRY+EFGIPVDWL DTGVVGKIKLSSVQLA+KYMKRV+ EL+++S +K+PNR
Sbjct: 887 RTRDMAISRYKEFGIPVDWLSDTGVVGKIKLSSVQLAKKYMKRVAYELDSVSGSDKDPNR 946
Query: 395 EFLLLQGVRFAFRVHQFAGGFDAESMKAFEVLRSRVHKQTVEDN 438
EFLLLQGVRFAFRVHQFAGGFDAESMKAFE LRSR ++ ++N
Sbjct: 947 EFLLLQGVRFAFRVHQFAGGFDAESMKAFEELRSRAKTESGDNN 990
|
|
| TAIR|locus:2831359 AT4G18570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2007755 AT1G48280 "AT1G48280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2007477 AT1G07120 "AT1G07120" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00030273001 | SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (959 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00002921001 | • | • | 0.413 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 442 | |||
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 8e-09 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 2e-08 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 3e-08 | |
| PRK12438 | 991 | PRK12438, PRK12438, hypothetical protein; Provisio | 2e-07 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 3e-07 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 3e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-07 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 8e-07 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 9e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-06 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 2e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-06 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-06 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 3e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 5e-06 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 6e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 8e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-05 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-05 | |
| PHA03291 | 401 | PHA03291, PHA03291, envelope glycoprotein I; Provi | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-05 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 4e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-05 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 5e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-05 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 5e-05 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 6e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 6e-05 | |
| PRK14723 | 767 | PRK14723, flhF, flagellar biosynthesis regulator F | 6e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 7e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 7e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 7e-05 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 7e-05 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 8e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 9e-05 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 9e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-04 | |
| PRK13729 | 475 | PRK13729, PRK13729, conjugal transfer pilus assemb | 1e-04 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 1e-04 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 1e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-04 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-04 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 2e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-04 | |
| pfam07415 | 489 | pfam07415, Herpes_LMP2, Gammaherpesvirus latent me | 2e-04 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 2e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-04 | |
| pfam06682 | 317 | pfam06682, DUF1183, Protein of unknown function (D | 3e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-04 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 4e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 4e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 4e-04 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 4e-04 | |
| pfam06003 | 264 | pfam06003, SMN, Survival motor neuron protein (SMN | 4e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 5e-04 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 5e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 6e-04 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 6e-04 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 6e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 6e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-04 | |
| PHA03291 | 401 | PHA03291, PHA03291, envelope glycoprotein I; Provi | 8e-04 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 8e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 9e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 9e-04 | |
| pfam06682 | 317 | pfam06682, DUF1183, Protein of unknown function (D | 9e-04 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 9e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.001 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.001 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.001 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 0.001 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.001 | |
| pfam12238 | 201 | pfam12238, MSA-2c, Merozoite surface antigen 2c | 0.001 | |
| pfam01213 | 313 | pfam01213, CAP_N, Adenylate cyclase associated (CA | 0.001 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 0.001 | |
| PRK09752 | 1250 | PRK09752, PRK09752, adhesin; Provisional | 0.001 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 0.001 | |
| PRK14952 | 584 | PRK14952, PRK14952, DNA polymerase III subunits ga | 0.001 | |
| pfam12868 | 135 | pfam12868, DUF3824, Domain of unknwon function (DU | 0.001 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.002 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 0.002 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.002 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.002 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.002 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.002 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.002 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.002 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.002 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.002 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 0.002 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 0.002 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.002 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 0.002 | |
| PRK03100 | 136 | PRK03100, PRK03100, sec-independent translocase; P | 0.002 | |
| pfam04834 | 97 | pfam04834, Adeno_E3_14_5, Early E3 14 | 0.002 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.003 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.003 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.003 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 0.003 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 0.003 | |
| pfam10138 | 98 | pfam10138, Tellurium_res, Tellurium resistance pro | 0.003 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 0.003 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.003 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 0.003 | |
| PRK09429 | 275 | PRK09429, mepA, penicillin-insensitive murein endo | 0.003 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.004 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.004 | |
| pfam12868 | 135 | pfam12868, DUF3824, Domain of unknwon function (DU | 0.004 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 0.004 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.004 | |
| PHA01732 | 94 | PHA01732, PHA01732, proline-rich protein | 0.004 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 0.004 |
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
Score = 56.1 bits (135), Expect = 8e-09
Identities = 27/67 (40%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
Query: 99 PPRVFRPPPKPSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPP--PGGPPPPPPPPG 156
P P P P P A PPPP A P PPPPP P PPPP P PG
Sbjct: 50 TAAAAPAPAAPPPPPPPAAPPAPQPDDPNAAPPPPPADPNAPPPPPVDPNAPPPPAPEPG 109
Query: 157 SLPRGVG 163
+ VG
Sbjct: 110 RIDNAVG 116
|
This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix. Length = 297 |
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221480 pfam12238, MSA-2c, Merozoite surface antigen 2c | Back alignment and domain information |
|---|
| >gnl|CDD|216368 pfam01213, CAP_N, Adenylate cyclase associated (CAP) N terminal | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|179538 PRK03100, PRK03100, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|147144 pfam04834, Adeno_E3_14_5, Early E3 14 | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220596 pfam10138, Tellurium_res, Tellurium resistance protein | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|236511 PRK09429, mepA, penicillin-insensitive murein endopeptidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 442 | |||
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 99.89 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 99.19 | |
| KOG1830 | 518 | consensus Wiskott Aldrich syndrome proteins [Cytos | 98.7 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 98.05 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 96.9 | |
| KOG1925 | 817 | consensus Rac1 GTPase effector FHOS [Signal transd | 96.05 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 95.67 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 95.27 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 94.46 | |
| PRK15319 | 2039 | AIDA autotransporter-like protein ShdA; Provisiona | 92.9 | |
| KOG3997 | 281 | consensus Major apurinic/apyrimidinic endonuclease | 91.71 | |
| PHA01732 | 94 | proline-rich protein | 90.38 | |
| KOG1922 | 833 | consensus Rho GTPase effector BNI1 and related for | 89.57 | |
| KOG4672 | 487 | consensus Uncharacterized conserved low complexity | 89.3 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 84.47 | |
| KOG1830 | 518 | consensus Wiskott Aldrich syndrome proteins [Cytos | 83.84 | |
| KOG0132 | 894 | consensus RNA polymerase II C-terminal domain-bind | 83.14 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 82.81 |
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
Probab=99.89 E-value=3.9e-23 Score=220.50 Aligned_cols=38 Identities=21% Similarity=0.333 Sum_probs=35.5
Q ss_pred cccCCCCccchhhhhhHHHHHHHHHHHHHHhhhccCCC
Q 036026 10 AEKYPAYKDRHKLALEREKQIKEKAEKARAYRFRDNSN 47 (442)
Q Consensus 10 ~~~~P~f~~r~~l~~d~~~~i~~~~~k~~~~~~~~~~~ 47 (442)
+|+||||+||+||+||++.+||.|+||++++++++++.
T Consensus 440 ~~~DPdf~yr~~l~id~~~liD~~vdkak~eeseqkA~ 477 (1102)
T KOG1924|consen 440 TGMDPDFKYRFRLDIDLTELIDKMVDKAKAEESEQKAA 477 (1102)
T ss_pred CCCCCCcchhhcccCcHHHHHHHHHHHHHHHHHHHHHH
Confidence 68999999999999999999999999999999997653
|
|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >PRK15319 AIDA autotransporter-like protein ShdA; Provisional | Back alignment and domain information |
|---|
| >KOG3997 consensus Major apurinic/apyrimidinic endonuclease/3'-repair diesterase APN1 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA01732 proline-rich protein | Back alignment and domain information |
|---|
| >KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 442 | |||
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-10 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-10 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-10 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 9e-10 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-09 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 1e-08 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 3e-08 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 1e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 4e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 7e-05 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 4e-09 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 1e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 9e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 3e-08 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 5e-06 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 9e-06 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 1e-05 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 1e-05 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 4e-05 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 7e-05 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 7e-08 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 1e-06 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 1e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 6e-07 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 1e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 2e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 3e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 3e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 1e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 1e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 2e-06 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 2e-04 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 2e-04 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 3e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 4e-06 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 7e-05 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 7e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 8e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 1e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 2e-04 | |
| 1jer_A | 138 | Cucumber stellacyanin; electron transport, copper, | 4e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 6e-05 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 1e-04 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 5e-04 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 8e-04 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 1e-04 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 2e-04 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-04 | |
| 1jvr_A | 137 | HTLV-II MA, MA, human T-cell leukemia virus type I | 3e-04 | |
| 2b5l_C | 222 | Nonstructural protein V; DDB1, SV5-V, beta propell | 3e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 3e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 5e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 6e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 8e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 3e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 6e-04 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 4e-04 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 6e-04 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 6e-04 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 5e-04 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 5e-04 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 6e-04 | |
| 4f6o_A | 350 | Metacaspase-1; rossmann fold, hydrolase; HET: DFH; | 6e-04 |
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
Score = 60.0 bits (145), Expect = 2e-10
Identities = 19/62 (30%), Positives = 20/62 (32%)
Query: 98 RPPRVFRPPPKPSGGAPAGTNANPSSGTPPAPPPPPGATPPPPPPPPPGGPPPPPPPPGS 157
V + P P PP GA PP PPPG PP PP G
Sbjct: 146 GRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGI 205
Query: 158 LP 159
P
Sbjct: 206 PP 207
|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1jvr_A HTLV-II MA, MA, human T-cell leukemia virus type II matrix protein; HTLV-II matrix protein, retroviral matrix protein; NMR {Human t-lymphotropic virus 2} SCOP: a.61.1.2 Length = 137 | Back alignment and structure |
|---|
| >2b5l_C Nonstructural protein V; DDB1, SV5-V, beta propeller, propeller cluster, zinc finger, protein binding/viral protein complex; 2.85A {Simian virus 5} PDB: 2hye_B* Length = 222 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Length = 388 | Back alignment and structure |
|---|
| >4f6o_A Metacaspase-1; rossmann fold, hydrolase; HET: DFH; 1.68A {Saccharomyces cerevisiae} Length = 350 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 442 | ||||
| d1jvra_ | 137 | a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell | 1e-04 | |
| d1jvra_ | 137 | a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell | 1e-04 | |
| d2gqba1 | 130 | a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { | 8e-04 | |
| d2gqba1 | 130 | a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { | 0.001 | |
| d2gqba1 | 130 | a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { | 0.001 | |
| d2gqba1 | 130 | a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { | 0.002 |
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00