Citrus Sinensis ID: 036054

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MLLGALVSFRTCVIATLAFVFIIVFSKSASAINDSQVKCSRTCVAENCNSVGIRYGKYCGVGWSGYPGEKPCDELDACCKIHDECVDKKGLTNIKCHEKFKRCIKKVQKFGNVGFSWKCPYDTVVPTMVQGMDMAILLSQLGNSKFEL
ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccc
**LGALVSFRTCVIATLAFVFIIVFSKSASAIN***VKCSRTCVAENCNSVGIRYGKYCGVGWSGYPGEKPCDELDACCKIHDECVDKKGLTNIKCHEKFKRCIKKVQKFGNVGFSWKCPYDTVVPTMVQGMDMAILLSQLG******
xxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLGALVSFRTCVIATLAFVFIIVFSKSASAINDSQVKCSRTCVAENCNSVGIRYGKYCGVGWSGYPGEKPCDELDACCKIHDECVDKKGLTNIKCHEKFKRCIKKVQKFGNVGFSWKCPYDTVVPTMVQGMDMAILLSQLGNSKFEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable phospholipase A2 homolog 1 PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides (By similarity). Releases lysophospholipids (LPLs) and free fatty acids (FFAs) from membrane phospholipids in response to hormones and other external stimuli.probableQ9XG80
Phospholipase A2-beta PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Releases lysophospholipids (LPLs) and free fatty acids (FFAs) from membrane phospholipids in response to hormones and other external stimuli. Regulates the process of cell elongation and plays important roles in shoot gravitropism by mediating auxin-induced cell elongation. Involved in stomatal opening in response to light. Plays a role in pollen development and germination and tube growth.probableQ8GZB4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WG7, chain A
Confidence level:very confident
Coverage over the Query: 26-145
View the alignment between query and template
View the model in PyMOL