Citrus Sinensis ID: 036071

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21

SKALRVMLRSVFLAIVLLSLACIRSIVRGSSASFLNIDIDDYDLGSKNFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVSSSLDTKFVDHVVKVGGIVVIQLIGDISDTYEKPSNYKLEYLRRYNSTILAMRRTALANELIDSSAKRQLCQWTLEAKKAALKDLEDGIA

cccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHcHHHHHHHHHHccccccccEEEEEEccccccCCccccccccccEEEEEcccccccccccccCEEEEEEcccccHHHHHcccccccEEEEEEccccccccccccccEEEEEEEEccEEEEEEEEcccccccccccHHHcccccHHHHHHHHHHHHHHHc

*KALRVMLRSVFLAIVLLSLACIRSIVRGSSA**LNIDIDDYDLGSKNFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVSSSLDTKFVDHVVKVGGIVVIQLIGDISDTYEKPSNYKLEYLRRYNSTILAMRRTALANELIDSSAKRQLCQWTLEAKKAALKDLEDGIA

xxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EVZ, chain A
Confidence level:confident
Coverage over the Query: 62-174
View the alignment between query and template
View the model in PyMOL