Citrus Sinensis ID: 036071

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21

SKALRVMLRSVFLAIVLLSLACIRSIVRGSSASFLNIDIDDYDLGSKNFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVSSSLDTKFVDHVVKVGGIVVIQLIGDISDTYEKPSNYKLEYLRRYNSTILAMRRTALANELIDSSAKRQLCQWTLEAKKAALKDLEDGIA

cccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHcHHHHHHHHHHccccccccEEEEEEccccccEEccccccccccEEEEEcccccccccccccEEEEEEEcccccHHHHHcccccccEEEEEEccccccccccccccEEEEEEEEccEEEEEEEEcccccccccccHHHcccccHHHHHHHHHHHHHHHc

cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccEccccEEEEEccHHHHHHccccccEEEEEEccccHHHHHHHHHccccEEEEEccccccHHccccccEEEEEEEccccEEEEEEEcccccccccccHHHHHcccHHHHHHHHHHHHHHHHc

SKALRVMLRSVFLAIVLLSLACIRSivrgssasflnididdydlgskNFEFLNLLFQDLgneglikkgdkallvgsgnigpviasskffndneihlvvksdlgqlgsiaderfdfsfvsssldtkfVDHVVKVGGIVVIQLIGdisdtyekpsnyklEYLRRYNSTILAMRRTALANELIDSSAKRQLCQWTLEAKKAALKDLEDGIA

SKALRVMLRSVFLAIVLLSLACIRSIvrgssasflnIDIDDYDLGSKNFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVSSSLDTKFVDHVVKVGGIVVIQligdisdtyekpsnykLEYLRRYNSTILAMRRTALANELIDSSAKRQLCQWTLEAKKAALkdledgia

SKALRVMLRSVFLAIVLLSLACIRSIVRGSSASFLNIDIDDYDLGSKNFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVSSSLDTKFvdhvvkvggivviqligDISDTYEKPSNYKLEYLRRYNSTILAMRRTALANELIDSSAKRQLCQWTLEAKKAALKDLEDGIA

**********************************LNIDIDDYDLGSKNFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVSSSLDTKFVDHVVKVGGIVVIQLIGDISDTYEKPSNYKLEYLRRYNSTILAMRRTALANELIDSSAKRQLCQWTLEA*************

*KALRVMLRSVFLAIVLLSLACIRSIVRGSSA*********YDLGSKNFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVSSSLDTKFVDHVVKVGGIVVIQLIGDISDTYEKPSNYKLEYLRRYNSTILAMRRTAL*****************LEAKKAALKDLEDGIA

iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		208
224095851		379	predicted protein [Populus trichocarpa]	0.961	0.527	0.5	8e-43
147766624		399	hypothetical protein VITISV_032248 [Viti	0.975	0.508	0.461	2e-41
359485369		426	PREDICTED: uncharacterized protein LOC10	0.975	0.476	0.461	3e-41
224141183		322	predicted protein [Populus trichocarpa]	0.745	0.481	0.519	7e-35
302142045		358	unnamed protein product [Vitis vinifera]	0.913	0.530	0.428	3e-33
359492482		403	PREDICTED: uncharacterized protein LOC10	0.913	0.471	0.428	3e-33
255563244		368	conserved hypothetical protein [Ricinus	0.692	0.391	0.481	5e-26
255545930		422	conserved hypothetical protein [Ricinus	0.956	0.471	0.359	6e-25
357476261		389	hypothetical protein MTR_4g093860 [Medic	0.942	0.503	0.349	4e-23
388499146		389	unknown [Medicago truncatula]	0.942	0.503	0.349	4e-23

>gi\|224095851\|ref\|XP_002310494.1\| predicted protein [Populus trichocarpa] gi\|222853397\|gb\|EEE90944.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 141/206 (68%), Gaps = 6/206 (2%)

Query: 1   SKALRVMLRSVFLAIVLLSLACIRSIVRG-SSASFLNIDIDDYDLGSKNFEFLNLLFQDL 59
           S+ +RV+ RS FLA+++L+L  + SI+R   S+S+     DD    S + E  +LL QDL
Sbjct: 12  SRVMRVVSRSFFLAMLVLTLPFVVSILRELDSSSY----YDDPGSASFDLESFDLLLQDL 67

Query: 60  GNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVS 119
             EGLIKKGDKAL+V SG +G V+ +S+F NDN+I  V +SDL Q     +  FDF+   
Sbjct: 68  AKEGLIKKGDKALIVCSG-VGAVVDTSRFLNDNDIDFVSESDLEQERLFPNATFDFALTL 126

Query: 120 SSLDTKFVDHVVKVGGIVVIQLIGDISDTYEKPSNYKLEYLRRYNSTILAMRRTALANEL 179
              D +FVD VVKVGGI+V QL  D S+ ++K SNY+  YLRRY+STI+AMR+T+L N++
Sbjct: 127 RIGDARFVDRVVKVGGILVTQLSSDPSNAFQKLSNYRAVYLRRYDSTIVAMRKTSLVNQV 186

Query: 180 IDSSAKRQLCQWTLEAKKAALKDLED 205
           + SSAKR+  Q  L+AKK AL+ LED
Sbjct: 187 VVSSAKRRPLQLALDAKKTALQGLED 212

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147766624\|emb\|CAN73947.1\| hypothetical protein VITISV_032248 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359485369\|ref\|XP_002273743.2\| PREDICTED: uncharacterized protein LOC100249012 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224141183\|ref\|XP_002323954.1\| predicted protein [Populus trichocarpa] gi\|222866956\|gb\|EEF04087.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|302142045\|emb\|CBI19248.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359492482\|ref\|XP_002283891.2\| PREDICTED: uncharacterized protein LOC100247170 [Vitis vinifera] gi\|147776518\|emb\|CAN74009.1\| hypothetical protein VITISV_003546 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255563244\|ref\|XP_002522625.1\| conserved hypothetical protein [Ricinus communis] gi\|223538101\|gb\|EEF39712.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|255545930\|ref\|XP_002514025.1\| conserved hypothetical protein [Ricinus communis] gi\|223547111\|gb\|EEF48608.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|357476261\|ref\|XP_003608416.1\| hypothetical protein MTR_4g093860 [Medicago truncatula] gi\|355509471\|gb\|AES90613.1\| hypothetical protein MTR_4g093860 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|388499146\|gb\|AFK37639.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		208
TAIR\|locus:2196240		420	AT1G58120 "AT1G58120" [Arabido	0.961	0.476	0.293	9.3e-14

TAIR\|locus:2196240 AT1G58120 "AT1G58120" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 185 (70.2 bits), Expect = 9.3e-14, P = 9.3e-14
 Identities = 62/211 (29%), Positives = 103/211 (48%)

Query:     1 SKALRVMLRSVFLAIVLLSLACIRSIVRGSSASFLNIDIDDYDLGSKNFEFLNLLFQDLG 60
             S+ L + +RS  LA++ LS   +  +  G++A+  +  ++  DL     E L LL  DL 
Sbjct:    43 SEVLSLFMRSTLLALLFLSFTWLSLLKYGTTATAPSKSVES-DLP----ELLPLLLNDLE 97

Query:    61 NEGLIKKGDKALLVGSGNIGPVIAS-SKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVS 119
              +GL K GDKAL +  G+    ++S S+   + ++ LV  SD      + DE FDF+F  
Sbjct:    98 KQGLFKMGDKALFLSGGDDEVTVSSYSQTVIETDMLLVSASDQEMQSMVPDETFDFAFAH 157

Query:   120 SS-LDT-KFXXXXXXXXXXXXXXXXX-DISDTYEKPSNYKLEYLRRYNSTILAMRRTALA 176
             S  +D+ +F                  D+   + K  NY++ Y++    T++ MR+T   
Sbjct:   158 SRHIDSAEFIDRTLKVGGIFTVQLNLQDLPPNFLKHPNYEIVYVKSSEYTVMTMRKTGET 217

Query:   177 NELIDSSAK-RQLCQWTLE-AKKAALKDLED 205
              +     A  R+L   T E A++ AL+ LED
Sbjct:   218 EQKQSLVATGRKLLGITEEDAREKALRKLED 248


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.136   0.375    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      208       191   0.00094  110 3  11 22  0.44    32
                                                     31  0.43    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  576 (61 KB)
  Total size of DFA:  137 KB (2085 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  15.53u 0.08s 15.61t   Elapsed:  00:00:00
  Total cpu time:  15.53u 0.08s 15.61t   Elapsed:  00:00:00
  Start:  Fri May 10 22:20:59 2013   End:  Fri May 10 22:20:59 2013

GO:0009860 "pollen tube growth" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		208
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	97.32
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	96.22
PLN02233		261	ubiquinone biosynthesis methyltransferase	95.31
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	95.2
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	95.12
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	94.78
PLN02244		340	tocopherol O-methyltransferase	94.65
KOG3045		325	consensus Predicted RNA methylase involved in rRNA	94.32
PRK00536		262	speE spermidine synthase; Provisional	94.04
PRK11088		272	rrmA 23S rRNA methyltransferase A; Provisional	93.95
PRK10258		251	biotin biosynthesis protein BioC; Provisional	93.57
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	93.22
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	92.75
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	92.54
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	92.43
PLN02232		160	ubiquinone biosynthesis methyltransferase	91.83
PLN02336		475	phosphoethanolamine N-methyltransferase	91.57
PRK00811		283	spermidine synthase; Provisional	91.27
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	91.15
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	90.77
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	90.74
TIGR00438		188	rrmJ cell division protein FtsJ.	90.3
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	89.49
COG0421		282	SpeE Spermidine synthase [Amino acid transport and	89.31
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	89.17
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	88.87
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	88.77
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	88.43
PRK04266		226	fibrillarin; Provisional	88.29
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	87.05
COG4122		219	Predicted O-methyltransferase [General function pr	85.83
PRK13255		218	thiopurine S-methyltransferase; Reviewed	85.63
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	84.98
PLN02490		340	MPBQ/MSBQ methyltransferase	84.95
PF01269		229	Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr	84.93
PF05148		219	Methyltransf_8: Hypothetical methyltransferase; In	84.44
PRK11207		197	tellurite resistance protein TehB; Provisional	84.38
PRK08317		241	hypothetical protein; Provisional	84.29
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	83.81
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	83.39
PF08541		90	ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC	83.37
PF02353		273	CMAS: Mycolic acid cyclopropane synthetase; InterP	82.5
PTZ00146		293	fibrillarin; Provisional	82.23
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	82.04
COG0293		205	FtsJ 23S rRNA methylase [Translation, ribosomal st	80.62
PF13578		106	Methyltransf_24: Methyltransferase domain; PDB: 3S	80.08

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

Probab=97.32  E-value=0.00018  Score=50.05  Aligned_cols=52  Identities=29%  Similarity=0.435  Sum_probs=36.7

Q ss_pred             ccccccCceeeeecCcccccCCCCCcceeEEEecCCC-----c---cchhccceeeCCEEEE
Q 036071           86 SKFFNDNEIHLVVKSDLGQLGSIADERFDFSFVSSSL-----D---TKFVDHVVKVGGIVVI  139 (208)
Q Consensus        86 ~~~l~~d~id~V~~~Dl~~q~~~~D~sfDFvf~~~f~-----~---~~FIDRtLK~GGI~a~  139 (208)
                      ++.....++. +...|.++.+ |+|+|||.++..+..     .   .+-+-|+||+||++++
T Consensus        36 ~~~~~~~~~~-~~~~d~~~l~-~~~~sfD~v~~~~~~~~~~~~~~~l~e~~rvLk~gG~l~~   95 (95)
T PF08241_consen   36 RKRLKNEGVS-FRQGDAEDLP-FPDNSFDVVFSNSVLHHLEDPEAALREIYRVLKPGGRLVI   95 (95)
T ss_dssp             HHHTTTSTEE-EEESBTTSSS-S-TT-EEEEEEESHGGGSSHHHHHHHHHHHHEEEEEEEEE
T ss_pred             HhcccccCch-heeehHHhCc-cccccccccccccceeeccCHHHHHHHHHHHcCcCeEEeC
Confidence            3444444455 6677788775 999999999998844     1   3449999999999975

The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. This entry represents a methyltransferase domain found in a large variety of SAM-dependent methyltransferases including, but not limited to: Arsenite methyltransferase (2.1.1.137 from EC) which converts arsenical compounds to their methylated forms [] Biotin synthesis protein bioC, which is involved in the early stages of biotin biosyntheis [] Arginine N-methyltransferase 1, an arginine-methylating enzyme which acts on residues present in a glycine and argine-rich domain and can methylate histones [] Hexaprenyldihydroxybenzoate methyltransferase (2.1.1.114 from EC), a mitochodrial enzyme involved in ubiquinone biosynthesis [] A probable cobalt-precorrin-6Y C(15)-methyltransferase thought to be involved in adenosylcobalamin biosynthesis [] Sterol 24-C-methyltransferase (2.1.1.41 from EC), shown to participate in ergosterol biosynthesis [] 3-demethylubiquinone-9 3-methyltransferase (2.1.1.64 from EC) involved in ubiquinone biosynthesis [] Structural studies show that this domain forms the Rossman-like alpha-beta fold typical of SAM-dependent methyltransferases [, , ]. ; GO: 0008168 methyltransferase activity, 0008152 metabolic process; PDB: 3CGG_B 3CCF_B 3BKW_B 2PXX_A 3I9F_A 2YQZ_B 2YR0_A 3BUS_A 3EGE_A 3G5L_B ....

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification]	Back alignment and domain information

>PRK00536 speE spermidine synthase; Provisional	Back alignment and domain information

>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>PLN02232 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>COG4122 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ]	Back alignment and domain information

>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2	Back alignment and domain information

>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4)	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		208
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	96.93
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	96.44
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	96.29
2esr_A		177	Methyltransferase; structural genomics, hypothetic	96.21
2ld4_A		176	Anamorsin; methyltransferase-like fold, alpha/beta	95.93
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	95.9
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	95.88
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	95.77
3f4k_A		257	Putative methyltransferase; structural genomics, P	95.64
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	95.53
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	95.49
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	95.36
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	95.27
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	95.26
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	95.23
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	95.15
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	95.14
1xxl_A		239	YCGJ protein; structural genomics, protein structu	95.03
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	94.96
3i9f_A		170	Putative type 11 methyltransferase; structural gen	94.96
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	94.94
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	94.82
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	94.73
2p7i_A		250	Hypothetical protein; putative methyltransferase,	94.71
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	94.7
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	94.58
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	94.51
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	94.42
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	94.37
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	94.27
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	94.26
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	94.13
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	94.13
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	94.08
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	94.03
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	94.03
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	93.96
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	93.95
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	93.83
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	93.79
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	93.77
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	93.76
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	93.75
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	93.72
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	93.67
3cc8_A		230	Putative methyltransferase; structural genomics, j	93.54
3o4f_A		294	Spermidine synthase; aminopropyltransferase, polya	93.51
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	93.49
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	93.48
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	93.26
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	93.15
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	93.08
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	93.07
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	93.07
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	93.06
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	93.04
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	92.93
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	92.85
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	92.84
2b25_A		336	Hypothetical protein; structural genomics, methyl	92.78
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	92.67
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	92.62
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	92.58
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	92.56
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	92.53
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	92.52
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	92.48
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	92.43
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	92.38
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	92.3
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	92.28
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	92.22
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	92.19
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	92.16
3lcc_A		235	Putative methyl chloride transferase; halide methy	92.16
3ege_A		261	Putative methyltransferase from antibiotic biosyn	92.08
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	92.06
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	92.05
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	91.96
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	91.81
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	91.79
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	91.63
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	91.59
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	91.59
2oxt_A		265	Nucleoside-2'-O-methyltransferase; flavivirus, vir	91.39
3ocj_A		305	Putative exported protein; structural genomics, PS	91.39
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	91.34
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	91.33
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	91.28
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	91.27
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	91.25
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	91.24
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	91.2
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	91.14
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	90.86
2frn_A		278	Hypothetical protein PH0793; structural genomics,	90.8
2i7c_A		283	Spermidine synthase; transferase, structural genom	90.61
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	90.55
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	90.54
2o07_A		304	Spermidine synthase; structural genomics, structur	90.48
2efj_A		384	3,7-dimethylxanthine methyltransferase; SAM-depend	90.37
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	90.25
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	90.17
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	90.11
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	90.08
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	90.03
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	89.52
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	89.51
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	89.48
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	89.46
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	89.45
3q7e_A		349	Protein arginine N-methyltransferase 1; HET: SAH;	89.15
1ws6_A		171	Methyltransferase; structural genomics, riken stru	89.1
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	89.09
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	88.87
2pt6_A		321	Spermidine synthase; transferase, structural genom	88.85
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	88.6
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	88.54
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	88.52
2g72_A		289	Phenylethanolamine N-methyltransferase; HET: SAM F	88.42
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	88.41
3sso_A		419	Methyltransferase; macrolide, natural product, ros	87.79
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	87.68
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	87.61
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	87.59
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	87.54
3b5i_A		374	S-adenosyl-L-methionine:salicylic acid carboxyl me	87.2
2cmg_A		262	Spermidine synthase; transferase, putrescine amino	86.6
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	86.36
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	85.69
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	85.14
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	84.97
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	84.78
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	84.74
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	84.65
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	84.43
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	83.88
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	83.83
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	83.78
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	83.68
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	83.44
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	82.78
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	82.77
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	82.67
3r3h_A		242	O-methyltransferase, SAM-dependent; structural gen	82.42
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	82.4
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	82.21
3c3y_A		237	Pfomt, O-methyltransferase; plant secondary metabo	81.49
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	80.99
1m6e_X		359	S-adenosyl-L-methionnine:salicylic acid carboxyl m	80.85
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	80.38
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	80.36
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	80.15

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

Probab=96.93  E-value=0.00089  Score=56.60  Aligned_cols=75  Identities=16%  Similarity=0.269  Sum_probs=48.1

Q ss_pred             CCCCeEEEeecCCCCcccc-ccccc-ccCceee---------------eecCcccccCCCCCcceeEEEecC-CC---cc
Q 036071           66 KKGDKALLVGSGNIGPVIA-SSKFF-NDNEIHL---------------VVKSDLGQLGSIADERFDFSFVSS-SL---DT  124 (208)
Q Consensus        66 k~g~KAL~vg~~~~g~~v~-~~~~l-~~d~id~---------------V~~~Dl~~q~~~~D~sfDFvf~~~-f~---~~  124 (208)
                      ..+.++|=||.|. |.... +.+.+ +..++|+               +-.+|.+..+ ++|++||.|++.. ++   +.
T Consensus        38 ~~~~~vLDvGcGt-G~~~~~l~~~~~~v~gvD~s~~ml~~a~~~~~v~~~~~~~e~~~-~~~~sfD~v~~~~~~h~~~~~  115 (257)
T 4hg2_A           38 PARGDALDCGCGS-GQASLGLAEFFERVHAVDPGEAQIRQALRHPRVTYAVAPAEDTG-LPPASVDVAIAAQAMHWFDLD  115 (257)
T ss_dssp             SCSSEEEEESCTT-TTTHHHHHTTCSEEEEEESCHHHHHTCCCCTTEEEEECCTTCCC-CCSSCEEEEEECSCCTTCCHH
T ss_pred             CCCCCEEEEcCCC-CHHHHHHHHhCCEEEEEeCcHHhhhhhhhcCCceeehhhhhhhc-ccCCcccEEEEeeehhHhhHH
Confidence            3457899999999 54432 22111 1112332               1145666665 8999999999876 22   33


Q ss_pred             ch---hccceeeCCEEEEEec
Q 036071          125 KF---VDHVVKVGGIVVIQLI  142 (208)
Q Consensus       125 ~F---IDRtLK~GGI~a~~l~  142 (208)
                      ++   +-|+||+||++++.-.
T Consensus       116 ~~~~e~~rvLkpgG~l~~~~~  136 (257)
T 4hg2_A          116 RFWAELRRVARPGAVFAAVTY  136 (257)
T ss_dssp             HHHHHHHHHEEEEEEEEEEEE
T ss_pred             HHHHHHHHHcCCCCEEEEEEC
Confidence            33   8999999999988654

PyMOL of 4hg2

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli}	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus}	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A*	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A*	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A*	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana}	Back alignment and structure

>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A*	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp}	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		208
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	97.18
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	97.12
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	96.8
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	96.78
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	96.7
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	96.56
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	96.23
d1jg1a_		215	Protein-L-isoaspartyl O-methyltransferase {Archaeo	95.94
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	95.67
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	95.6
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	95.47
d1i1na_		224	Protein-L-isoaspartyl O-methyltransferase {Human (	95.06
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	94.61
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	94.51
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	94.45
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	94.32
d1pjza_		201	Thiopurine S-methyltransferase {Pseudomonas syring	94.01
d2bzga1		229	Thiopurine S-methyltransferase {Human (Homo sapien	93.86
d1xj5a_		290	Spermidine synthase {Thale cress (Arabidopsis thal	93.74
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	93.71
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	92.9
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	92.79
d1kpia_		291	CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	92.77
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	92.55
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	92.54
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	92.52
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	92.28
d2fk8a1		280	Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri	90.58
d1ej0a_		180	RNA methyltransferase FtsJ {Escherichia coli [TaxI	90.57
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	90.4
d1uira_		312	Spermidine synthase {Thermus thermophilus [TaxId:	90.23
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	89.64
d2o07a1		285	Spermidine synthase {Human (Homo sapiens) [TaxId:	89.53
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	89.52
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	89.47
d1iy9a_		274	Spermidine synthase {Bacillus subtilis [TaxId: 142	88.76
d2b2ca1		312	Spermidine synthase {Caenorhabditis elegans [TaxId	88.7
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	88.41
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	88.34
d1g6q1_		328	Arginine methyltransferase, HMT1 {Baker's yeast (S	87.85
d1inla_		295	Spermidine synthase {Thermotoga maritima [TaxId: 2	87.29
d1kpga_		285	CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	87.03
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	86.81
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	86.24
d1nw3a_		328	Catalytic, N-terminal domain of histone methyltran	84.62
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	83.28
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	82.9
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	82.12
d2a14a1		257	Indolethylamine N-methyltransferase, INMT {Human (	82.06
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	81.87
d1u2za_		406	Catalytic, N-terminal domain of histone methyltran	80.83

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Mycolic acid cyclopropane synthase
domain: Putative sarcosine dimethylglycine methyltransferase
species: Red algae (Galdieria sulphuraria) [TaxId: 130081]

Probab=97.18  E-value=0.0002  Score=57.82  Aligned_cols=91  Identities=21%  Similarity=0.289  Sum_probs=61.9

Q ss_pred             hhHHHHHHHhccccCCCCCCeEEEeecCCCCccccccccc--ccCceee----------------------eecCccccc
Q 036071           50 EFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFF--NDNEIHL----------------------VVKSDLGQL  105 (208)
Q Consensus        50 ~~l~lLf~DL~~EGLLk~g~KAL~vg~~~~g~~v~~~~~l--~~d~id~----------------------V~~~Dl~~q  105 (208)
                      .....+.+.|...+-|++|++.|=||.|.|+....+..-.  +..++|+                      +-..|.+..
T Consensus        50 ~~~~~~~~~l~~~~~l~~~~~vLDiGcG~G~~~~~la~~~~~~v~gvD~s~~~i~~a~~~~~~~gl~~~v~~~~~d~~~l  129 (282)
T d2o57a1          50 RTDEWLASELAMTGVLQRQAKGLDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKRNEEYNNQAGLADNITVKYGSFLEI  129 (282)
T ss_dssp             HHHHHHHHHHHHTTCCCTTCEEEEETCTTSHHHHHHHHHHCCEEEEEESCHHHHHHHHHHHHHHTCTTTEEEEECCTTSC
T ss_pred             HHHHHHHHHHHHhcCCCCCCEEEEeCCCCcHHHhhhhccCCcEEEEEeccchhhhhhhcccccccccccccccccccccc
Confidence            4456677888888999999999999999953222222111  1113332                      224677776


Q ss_pred             CCCCCcceeEEEecC-CC----ccc---hhccceeeCCEEEEEe
Q 036071          106 GSIADERFDFSFVSS-SL----DTK---FVDHVVKVGGIVVIQL  141 (208)
Q Consensus       106 ~~~~D~sfDFvf~~~-f~----~~~---FIDRtLK~GGI~a~~l  141 (208)
                      + +++++||.|++.. +.    +.+   -+-|+||+||++++.-
T Consensus       130 ~-~~~~sfD~V~~~~~l~h~~d~~~~l~~~~~~LkpgG~l~~~~  172 (282)
T d2o57a1         130 P-CEDNSYDFIWSQDAFLHSPDKLKVFQECARVLKPRGVMAITD  172 (282)
T ss_dssp             S-SCTTCEEEEEEESCGGGCSCHHHHHHHHHHHEEEEEEEEEEE
T ss_pred             c-ccccccchhhccchhhhccCHHHHHHHHHHhcCCCcEEEEEE
Confidence            6 9999999999865 22    233   3889999999988863

PyMOL of d2o57a1

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure