Citrus Sinensis ID: 036114


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAYTST
ccccccccccccEEccEEcccccEEEEEEEEEcccccccccccccccccccccccccccccccEEcccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEcccccEEEEEEEEccc
cccccccccccEEEccEEEccccEEEEEHHHHHcccccccccccccHHHHccHHcccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEccccEEEEEcccccc
pllvprettedcrigeyeipsgtrVLINAKaiatdpeywehpfefrperflnssidfkgqnyelipfgvgrracpginfAIPLIELALASLLYsfdwelppgmriedfdmeeapgitmhKKTLLFLMATAYTST
pllvprettedcrigeyeipsgtrvlINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAYTST
PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAYTST
***********CRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAY***
PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAYT**
PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAYTST
PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAYTST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query134 2.2.26 [Sep-21-2011]
O81970499 Cytochrome P450 71A9 OS=G yes no 0.977 0.262 0.671 1e-48
P24465502 Cytochrome P450 71A1 OS=P N/A no 0.992 0.264 0.586 3e-41
O48923510 Cytochrome P450 71D10 OS= no no 0.947 0.249 0.598 2e-40
Q6QNI4494 Psoralen synthase OS=Ammi N/A no 0.955 0.259 0.585 2e-39
C0SJS2473 Psoralen synthase (Fragme N/A no 0.910 0.257 0.606 2e-39
C0SJS4476 Psoralen synthase (Fragme N/A no 0.902 0.254 0.586 8e-39
Q6YV88518 Ent-cassadiene C2-hydroxy no no 0.925 0.239 0.572 6e-38
Q947B7493 (+)-menthofuran synthase N/A no 0.985 0.267 0.545 6e-38
O04164511 Cytochrome P450 71A6 (Fra N/A no 1.0 0.262 0.537 1e-37
Q9LIP3500 Cytochrome P450 71B37 OS= yes no 0.977 0.262 0.526 2e-37
>sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 Back     alignment and function desciption
 Score =  191 bits (485), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 109/131 (83%)

Query: 1   PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQ 60
           PLLVPRE TE+C I  +EIP+ TRVL+NAK+IA DP  WE+P EF PERFL S IDFKGQ
Sbjct: 367 PLLVPREITENCTIKGFEIPAKTRVLVNAKSIAMDPCCWENPNEFLPERFLVSPIDFKGQ 426

Query: 61  NYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHK 120
           ++E++PFGVGRR CPG+NFA+P++ELALA+LL+ FDWELP G+ I+D DMEEA GIT+HK
Sbjct: 427 HFEMLPFGVGRRGCPGVNFAMPVVELALANLLFRFDWELPLGLGIQDLDMEEAIGITIHK 486

Query: 121 KTLLFLMATAY 131
           K  L+L AT +
Sbjct: 487 KAHLWLKATPF 497





Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function description
>sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 Back     alignment and function description
>sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 Back     alignment and function description
>sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 Back     alignment and function description
>sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 Back     alignment and function description
>sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 Back     alignment and function description
>sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 Back     alignment and function description
>sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
359491181 952 PREDICTED: uncharacterized protein LOC10 0.962 0.135 0.682 5e-50
297733668 416 unnamed protein product [Vitis vinifera] 0.962 0.310 0.682 1e-48
255639761 499 unknown [Glycine max] 0.977 0.262 0.671 8e-47
358248834 499 cytochrome P450 71A9 precursor [Glycine 0.977 0.262 0.671 8e-47
252972605 500 cytochrome P450 [Nicotiana tabacum] gi|2 0.985 0.264 0.651 1e-46
85068670 494 CYP71AH2 [Nicotiana tabacum] 0.985 0.267 0.643 9e-46
225458059 496 PREDICTED: cytochrome P450 83B1-like [Vi 0.977 0.264 0.625 7e-43
302142620 912 unnamed protein product [Vitis vinifera] 0.985 0.144 0.621 9e-43
225458053 498 PREDICTED: cytochrome P450 83B1 [Vitis v 0.985 0.265 0.621 1e-42
225458055 495 PREDICTED: cytochrome P450 83B1 [Vitis v 0.955 0.258 0.648 2e-42
>gi|359491181|ref|XP_003634235.1| PREDICTED: uncharacterized protein LOC100248387 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 88/129 (68%), Positives = 108/129 (83%)

Query: 1   PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQ 60
           PLLVPR+T EDC I  YE+P+ T+V +N K+IATDP YWE+P EF+PERFL+S+IDF+GQ
Sbjct: 821 PLLVPRKTNEDCTIRGYEVPANTQVFVNGKSIATDPNYWENPNEFQPERFLDSAIDFRGQ 880

Query: 61  NYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHK 120
           N+EL+PFG GRR CP +NFA+ LIELALA+LL+ FDWEL  GMR ED DMEEA GIT+HK
Sbjct: 881 NFELLPFGAGRRGCPAVNFAVLLIELALANLLHRFDWELADGMRREDLDMEEAIGITVHK 940

Query: 121 KTLLFLMAT 129
           K  L+L+AT
Sbjct: 941 KNPLYLLAT 949




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297733668|emb|CBI14915.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255639761|gb|ACU20174.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|358248834|ref|NP_001239692.1| cytochrome P450 71A9 precursor [Glycine max] gi|5915816|sp|O81970.1|C71A9_SOYBN RecName: Full=Cytochrome P450 71A9; AltName: Full=Cytochrome P450 CP1 gi|3334659|emb|CAA71513.1| putative cytochrome P450 [Glycine max] Back     alignment and taxonomy information
>gi|252972605|dbj|BAH84782.1| cytochrome P450 [Nicotiana tabacum] gi|291277951|gb|ADD91443.1| cytochrome P450 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|85068670|gb|ABC69415.1| CYP71AH2 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|225458059|ref|XP_002278372.1| PREDICTED: cytochrome P450 83B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142620|emb|CBI19823.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458053|ref|XP_002280472.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] gi|147832399|emb|CAN64422.1| hypothetical protein VITISV_032274 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458055|ref|XP_002278300.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
UNIPROTKB|Q6QNI4494 CYP71AJ1 "Psoralen synthase" [ 0.955 0.259 0.585 1.7e-36
UNIPROTKB|Q6YV88518 CYP71Z7 "Ent-cassadiene C2-hyd 0.925 0.239 0.572 1.9e-35
UNIPROTKB|Q947B7493 Q947B7 "(+)-menthofuran syntha 0.955 0.259 0.554 8.3e-35
TAIR|locus:2079316500 CYP71B37 ""cytochrome P450, fa 0.977 0.262 0.526 1.1e-34
TAIR|locus:2093521500 CYP71B22 ""cytochrome P450, fa 0.977 0.262 0.519 1.3e-34
TAIR|locus:2102033498 CYP71B31 ""cytochrome P450, fa 0.962 0.259 0.542 2.8e-34
TAIR|locus:2079251500 CYP71B34 ""cytochrome P450, fa 0.977 0.262 0.503 4.6e-34
UNIPROTKB|Q9XHE8496 CYP71D18 "Cytochrome P450 71D1 0.977 0.264 0.511 5.8e-34
TAIR|locus:2093561500 CYP71B26 ""cytochrome P450, fa 0.977 0.262 0.511 2e-33
TAIR|locus:2043694511 CYP76C4 ""cytochrome P450, fam 0.932 0.244 0.52 4.1e-33
UNIPROTKB|Q6QNI4 CYP71AJ1 "Psoralen synthase" [Ammi majus (taxid:48026)] Back     alignment and assigned GO terms
 Score = 393 (143.4 bits), Expect = 1.7e-36, P = 1.7e-36
 Identities = 75/128 (58%), Positives = 96/128 (75%)

Query:     1 PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQ 60
             PLLVPRE  +D +   Y+I SGT+VLINA AIA DP  W+ P EFRPERFLNS ID+KG 
Sbjct:   363 PLLVPREARQDIKFMGYDISSGTQVLINAWAIARDPLLWDKPEEFRPERFLNSPIDYKGF 422

Query:    61 NYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHK 120
             +YE +PFG GRR CPGI FA+ + EL +A+L++ F++ELP G R+ED DM  A GIT+ K
Sbjct:   423 HYEFLPFGAGRRGCPGIQFAMCINELVVANLVHKFNFELPDGKRLEDLDMTAASGITLRK 482

Query:   121 KTLLFLMA 128
             K+ L ++A
Sbjct:   483 KSPLLVVA 490




GO:0002238 "response to molecule of fungal origin" evidence=IDA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
UNIPROTKB|Q6YV88 CYP71Z7 "Ent-cassadiene C2-hydroxylase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q947B7 Q947B7 "(+)-menthofuran synthase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093521 CYP71B22 ""cytochrome P450, family 71, subfamily B, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102033 CYP71B31 ""cytochrome P450, family 71, subfamily B, polypeptide 31"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XHE8 CYP71D18 "Cytochrome P450 71D18" [Mentha spicata (taxid:29719)] Back     alignment and assigned GO terms
TAIR|locus:2093561 CYP71B26 ""cytochrome P450, family 71, subfamily B, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043694 CYP76C4 ""cytochrome P450, family 76, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-40
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 3e-38
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-38
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-38
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 9e-37
pfam00067461 pfam00067, p450, Cytochrome P450 1e-36
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-35
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 6e-34
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 3e-24
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 4e-19
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-17
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-17
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-14
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 8e-14
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 2e-12
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-10
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-10
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 7e-10
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 9e-10
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 2e-09
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 2e-09
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 1e-08
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 6e-06
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 2e-04
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 6e-04
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
 Score =  140 bits (354), Expect = 2e-40
 Identities = 57/124 (45%), Positives = 82/124 (66%), Gaps = 4/124 (3%)

Query: 1   PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFL----NSSID 56
           PL +PR   E+C I  Y IP G  +L+N  AIA DPE W  P EFRP+RFL    ++ +D
Sbjct: 374 PLSLPRMAAEECEINGYHIPKGATLLVNVWAIARDPEQWPDPLEFRPDRFLPGGEHAGVD 433

Query: 57  FKGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGI 116
            KG ++ELIPFG GRR C G+++ + ++ L  A+L+++FDWEL  G   +  +MEEA G+
Sbjct: 434 VKGSDFELIPFGAGRRICAGLSWGLRMVTLLTATLVHAFDWELADGQTPDKLNMEEAYGL 493

Query: 117 TMHK 120
           T+ +
Sbjct: 494 TLQR 497


Length = 517

>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 134
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02183516 ferulate 5-hydroxylase 99.98
PLN02687517 flavonoid 3'-monooxygenase 99.98
PLN02966502 cytochrome P450 83A1 99.98
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.98
PTZ00404482 cytochrome P450; Provisional 99.98
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.98
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.97
PLN03112514 cytochrome P450 family protein; Provisional 99.97
PLN02655466 ent-kaurene oxidase 99.97
PLN02500490 cytochrome P450 90B1 99.97
PLN03018534 homomethionine N-hydroxylase 99.97
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.97
PLN02738633 carotene beta-ring hydroxylase 99.97
PLN02290516 cytokinin trans-hydroxylase 99.97
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.97
PLN02774463 brassinosteroid-6-oxidase 99.97
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.97
PLN02302490 ent-kaurenoic acid oxidase 99.97
PLN02936489 epsilon-ring hydroxylase 99.97
PLN02987472 Cytochrome P450, family 90, subfamily A 99.96
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.96
PLN02196463 abscisic acid 8'-hydroxylase 99.96
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.94
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.93
PLN02648480 allene oxide synthase 99.91
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=1.3e-33  Score=215.53  Aligned_cols=126  Identities=37%  Similarity=0.607  Sum_probs=110.4

Q ss_pred             cceecCCCceEe-cEEeCCCCEEEechhhhccCcCCCCCCCccCCCCcCCCCcCCCCCCccccccCCCCCCCccHHHHHH
Q 036114            4 VPRETTEDCRIG-EYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAIP   82 (134)
Q Consensus         4 ~~R~~~~d~~l~-g~~ip~g~~v~~~~~~~~~~~~~~~~p~~F~P~R~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~a~~   82 (134)
                      +.|+|++|+++. ++.|+||+.|.++.|++||||++|+||++|+||||.+++.+ ...+..|+|||.|+|.|+|.+||++
T Consensus       373 ~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~-~~~~~~ylPFG~GPR~CIGmRfa~m  451 (499)
T KOG0158|consen  373 LNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNK-SRHPGAYLPFGVGPRNCIGMRFALM  451 (499)
T ss_pred             ccceecCceecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCccc-ccCCccccCCCCCccccHHHHHHHH
Confidence            679999999999 99999999999999999999999999999999999977643 4467899999999999999999999


Q ss_pred             HHHHHHHHHHHhCceecCCCCCCCCCCCCCCCCeeeccCCcEEEEEeecc
Q 036114           83 LIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAYT  132 (134)
Q Consensus        83 ~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R~  132 (134)
                      |+|+.|+.||++|+++..+.+. .. ......++++.+++++.+++.+|.
T Consensus       452 q~K~~L~~lL~~f~~~~~~~t~-~~-~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  452 EAKLALAHLLRNFSFEVCPTTI-IP-LEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             HHHHHHHHHHhhCEEecCCccc-Cc-ccCCccceeeecCCceEEEEEeCC
Confidence            9999999999999999887332 22 222234778899999999999884



>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 6e-15
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-14
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-13
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-13
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 7e-13
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-12
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 5e-12
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 5e-12
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 2e-10
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-10
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-10
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 2e-10
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-09
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-09
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 3e-09
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 5e-09
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 5e-09
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-08
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 2e-08
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 2e-08
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-08
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-08
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-08
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-08
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-08
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-08
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 3e-08
3pm0_A507 Structural Characterization Of The Complex Between 3e-08
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 4e-08
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 4e-08
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 4e-08
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 4e-08
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 4e-08
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 8e-08
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-07
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 2e-07
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-07
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 3e-07
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-07
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 3e-07
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-07
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-07
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 4e-07
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 4e-07
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 4e-07
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-07
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 5e-07
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 5e-07
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 5e-07
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 5e-07
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 5e-07
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 5e-07
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-07
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 5e-07
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 5e-07
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 5e-07
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 5e-07
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-07
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 5e-07
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 5e-07
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 5e-07
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 5e-07
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 5e-07
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 5e-07
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 5e-07
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 5e-07
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 5e-07
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 5e-07
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 5e-07
1fah_A471 Structure Of Cytochrome P450 Length = 471 5e-07
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 5e-07
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 6e-07
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 8e-07
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-06
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-06
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 3e-06
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-06
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 1e-05
3b98_A475 Crystal Structure Of Zebrafish Prostacyclin Synthas 4e-05
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 5e-05
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 5e-05
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 8e-05
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 8e-05
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 8e-05
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 8e-05
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 9e-05
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 9e-05
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 9e-05
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-04
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 2e-04
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 2e-04
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 3e-04
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 3e-04
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 3e-04
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 3e-04
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 3e-04
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 3e-04
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 9e-04
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 6e-15, Method: Composition-based stats. Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 7/121 (5%) Query: 1 PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLN---SSIDF 57 P +P TT D + + IP V +N + DPE WE P EFRPERFL ++I+ Sbjct: 359 PFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPELWEDPSEFRPERFLTADGTAIN- 417 Query: 58 KGQNYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGIT 117 K + +++ FG+G+R C G A I L LA LL ++ +PPG+++ D+ G+T Sbjct: 418 KPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPPGVKV---DLTPIYGLT 474 Query: 118 M 118 M Sbjct: 475 M 475
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3B98|A Chain A, Crystal Structure Of Zebrafish Prostacyclin Synthase (Cytochrome P450 8a1) Length = 475 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-49
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-46
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 6e-46
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-41
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-33
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-33
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 6e-33
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-32
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-30
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-29
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-29
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-29
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 9e-29
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-28
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-28
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-27
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 8e-27
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-26
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-26
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-25
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 2e-25
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-25
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-25
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 5e-22
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-20
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-20
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 5e-18
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-17
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 4e-17
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 2e-05
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 7e-05
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 1e-04
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 1e-04
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 1e-04
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 2e-04
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 4e-04
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 6e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  162 bits (413), Expect = 3e-49
 Identities = 34/144 (23%), Positives = 57/144 (39%), Gaps = 15/144 (10%)

Query: 1   PLLVPRETTEDCRI-----GEYEIPSGTRVLINA-KAIATDPEYWEHPFEFRPERFLNSS 54
             L+ R+ T+D +I      EY +  G R+ +    +   DP+  + P  F+ +RFLN+ 
Sbjct: 325 AALITRDVTQDKKICLSNGQEYHLRRGDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNAD 384

Query: 55  IDFKGQ--------NYELIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIE 106
              K           Y  +P+G     CPG +FA+  I+  + ++L  FD EL       
Sbjct: 385 RTEKKDFFKNGARVKYPSVPWGTEDNLCPGRHFAVHAIKELVFTILTRFDVELCDKNATV 444

Query: 107 DFDMEEAPGI-TMHKKTLLFLMAT 129
                   G   +     L +   
Sbjct: 445 PLVDPSRYGFGILQPAGDLEIRYR 468


>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.98
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.98
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.97
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.97
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.97
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.97
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.97
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.97
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.97
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.97
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.97
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.97
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.97
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.96
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.96
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.96
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.96
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.96
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.96
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.96
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.96
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.96
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.96
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.96
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.96
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.96
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.96
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.96
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.96
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.96
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.96
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.96
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.96
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.96
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.96
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.96
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.96
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.96
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.96
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.96
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.96
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.96
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.95
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.95
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.95
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.95
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.95
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.95
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.95
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.95
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.95
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.95
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.95
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.95
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.95
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.95
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.95
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.94
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.94
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.93
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.93
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.93
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.92
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=7.2e-36  Score=225.81  Aligned_cols=129  Identities=30%  Similarity=0.508  Sum_probs=107.3

Q ss_pred             CcccceecCCCceEecEEeCCCCEEEechhhhccCcCCCCCCCccCCCCcCCCCcCCCCCCccccccCCCCCCCccHHHH
Q 036114            1 PLLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFA   80 (134)
Q Consensus         1 p~~~~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~~~~~~~~p~~F~P~R~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~a   80 (134)
                      |+.+.|.+.+|++++||.||||+.|.++.+++||||++|+||++|+||||++++... ..+..|+|||+|+|.|+|++||
T Consensus       349 ~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~-~~~~~~~pFG~G~R~C~G~~lA  427 (479)
T 3tbg_A          349 PLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHF-VKPEAFLPFSAGRRACLGEPLA  427 (479)
T ss_dssp             TTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCB-CCCTTCCTTCCSTTSCTTHHHH
T ss_pred             cccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCccc-CCCCceecCCCCCcCChhHHHH
Confidence            345667888999999999999999999999999999999999999999999876433 3567899999999999999999


Q ss_pred             HHHHHHHHHHHHHhCceecCCCCCCCCCCCCCCCCeeeccCCcEEEEEeeccC
Q 036114           81 IPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAYTS  133 (134)
Q Consensus        81 ~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R~~  133 (134)
                      ++|+++++|.|+++|++++++++.  ........+++..|. ++.|++++|+.
T Consensus       428 ~~e~~~~la~ll~~f~~~~~~~~~--~~~~~~~~~~~~~P~-~~~v~~~pRs~  477 (479)
T 3tbg_A          428 RMELFLFFTSLLQHFSFSVPTGQP--RPSHHGVFAFLVSPS-PYELCAVPRHH  477 (479)
T ss_dssp             HHHHHHHHHHHHHHEEEECCTTSC--CCCSCEEESSSEEEC-CCCBEEEEC--
T ss_pred             HHHHHHHHHHHHHccEEEeCCCCC--CccccccceeeecCC-CeEEEEEECCC
Confidence            999999999999999999987653  222222334555554 78999999974



>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 134
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-31
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-31
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-29
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-25
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 8e-23
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-22
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-19
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-17
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 8e-17
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 4e-16
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 9e-16
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 5e-15
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-14
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 6e-14
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 1e-12
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-12
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-12
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 3e-12
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 7e-12
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-10
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 3e-10
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  114 bits (285), Expect = 1e-31
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 4/126 (3%)

Query: 4   VPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYE 63
           + R   +D  I    IP G  V+I + A+  DP+YW  P +F PERF   + D     Y 
Sbjct: 346 LERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKD-NIDPYI 404

Query: 64  LIPFGVGRRACPGINFAIPLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTL 123
             PFG G R C G+ FA+  ++LAL  +L +F ++     +I    ++ + G  +  +  
Sbjct: 405 YTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQI---PLKLSLGGLLQPEKP 461

Query: 124 LFLMAT 129
           + L   
Sbjct: 462 VVLKVE 467


>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.98
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.98
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.96
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.96
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.96
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.96
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.96
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.96
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.96
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.95
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.95
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.95
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.95
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.95
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.95
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.94
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.94
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1e-34  Score=214.82  Aligned_cols=125  Identities=34%  Similarity=0.568  Sum_probs=108.0

Q ss_pred             cccceecCCCceEecEEeCCCCEEEechhhhccCcCCCCCCCccCCCCcCCCCcCCCCCCccccccCCCCCCCccHHHHH
Q 036114            2 LLVPRETTEDCRIGEYEIPSGTRVLINAKAIATDPEYWEHPFEFRPERFLNSSIDFKGQNYELIPFGVGRRACPGINFAI   81 (134)
Q Consensus         2 ~~~~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~~~~~~~~p~~F~P~R~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~a~   81 (134)
                      ..+.|.+.+|+.++|+.||||+.|+++.+++|+|+++|+||++|+||||++++... ..+..|+|||+|+|.|+|++||+
T Consensus       338 ~~~~r~~~~~~~~~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~-~~~~~~~~FG~G~r~C~G~~~A~  416 (463)
T d3czha1         338 LGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYF-AKKEALVPFSLGRRHCLGEHLAR  416 (463)
T ss_dssp             TCSCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBCTTSCB-CCCTTCCTTCCSTTCCTTHHHHH
T ss_pred             ccceecccCCcccCCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCCCcccc-CCCCceeCCCCCCcCCchHHHHH
Confidence            45678889999999999999999999999999999999999999999999876433 35678999999999999999999


Q ss_pred             HHHHHHHHHHHHhCceecCCCCCCCCCCCCCCCCeeeccCCcEEEEEeec
Q 036114           82 PLIELALASLLYSFDWELPPGMRIEDFDMEEAPGITMHKKTLLFLMATAY  131 (134)
Q Consensus        82 ~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R  131 (134)
                      +|+++++|.|+++|++++.++.   ..++....++++.|. ++.|++++|
T Consensus       417 ~~~~~~la~ll~~f~~~~~~~~---~~~~~~~~~~~~~p~-~~~v~~~~R  462 (463)
T d3czha1         417 MEMFLFFTALLQRFHLHFPHEL---VPDLKPRLGMTLQPQ-PYLICAERR  462 (463)
T ss_dssp             HHHHHHHHHHHHHEEEECGGGC---CCCCCCCSSSSCCCC-CCCBEEEEC
T ss_pred             HHHHHHHHHHHHhcEEEeCCCC---CCCceeccCeEEecc-CcEEEEEeC
Confidence            9999999999999999997654   234455566666665 778988887



>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure