Citrus Sinensis ID: 036169


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------62
PSGSKGEITSLLSNHFKVSITGASGHIFHYSGIRRKIIDKVCETNSADLAEKDIAYDGEKSLFTIGALPHKKNGVPDLSQTTSNDSPDGHGSNNERDKKRRRVSQSKTFKVEISFPAKIPLPAIAAALHGQESQNSREAFRVLDIILRQHAAKQMNLGVSLTLEVVFLDLGCWGFHSSFQATQGGLSLNIDGSTTSIIKPGPLVDFLIANQNVHDCYQLHWAKAKRTLKNLRIRVHPFNREYRITGLSDSTCKRQMFSWKSGVKDRNGDVKCVDVTVFDYFVNHGRINLCFSGDFPCIDVGKPRKPTYIPIEPCSLLSLQRYTKALTVFQRSALVEKSQQKPQEKMKIITDVMRSNKYDSEPMLRSCAISINSRFAKVEGRILSAPRGAYHPKNGRWSFHNKIFVQAAKIDHWAVVNFSARYDIRSLCRDLIRFGEMKGIVTPVRADRMFVQMKQKFEKCPCFLLCLLPDKKDSDLYGSWKRKTLSEFGIFNQCLAPTKVNEHDLMNVLLKINANCQRELTDPLILLGGLNSLLAIEQSKNLPLVSKVPTIIFGMDVSHGSPGHSNVPSVATVGCNSFSRNWPILSRYRASVRSQSAKLEMTDSLFKPLPNKDDAAIVR
cccccccEEEEEEEEEEEEECcccCEEEECccccHHHHHHHHHHcccccccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccEEEccccccCEEEEEEEEECcccCEEEccccCEEEEccccHHHHHHHHcccccccHHHHHHHHHHccccEEECccccCEEEEcccccccccccEEccccccccccccccccEEEHHHHHHHHccccEEccccccCEECcccccccccccccEEEcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHccccEEEccEEEEEEEEEcccccccccccccEEECccccEEccccccEEEEEEEccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccEEEEEEcccccccccccEEEECccccccEEEECccccccHHHHHHHHHHHHHcccccccccEEccccccEEEcccccccccccccccEEEEEECcccccccccccccEEEEEEECccccccccccEEEEEEEcccccHHHHHHcccccccccccccc
*SGSKGEITSLLSNHFKVSITGASGHIFHYSGIRRKIIDKVCETNSADLAEKDIAYDGEKSLFTIGALPHKKNGVPDLSQTTSN********************QSKTFKVEISFPAKIPLPAIAAALHGQESQNSREAFRVLDIILRQHAAKQMNLGVSLTLEVVFLDLGCWGFHSSFQATQGGLSLNIDGSTTSIIKPGPLVDFLIANQNVHDCYQLHWAKAKRTLKNLRIRVHPFNREYRITGLSDSTCKRQMF************VKCVDVTVFDYFVNHGRINLCFSGDFPCIDVGKPRKPTYIPIEPCSLLSLQRYTKALTVFQRSAL***********MKIITDVMRSNKYDSEPMLRSCAISINSRFAKVEGRILSAPRGAYHPKNGRWSFHNKIFVQAAKIDHWAVVNFSARYDIRSLCRDLIRFGEMKGIVTPVRADRMFVQMKQKFEKCPCFLLCLLPDKKDSDLYGSWKRKTLSEFGIFNQCLAPTKVNEHDLMNVLLKINANCQRELTDPLILLGGLNSLLAIEQSKNLPLVSKVPTIIFGMDVSHGSP***NVPSVATVGCNSFSRNWPILSRYRASVRSQSAKLEMTDSLFKPLPNKDDAAIVR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PSGSKGEITSLLSNHFKVSITGASGHIFHYSGIRRKIIDKVCETNSADLAEKDIAYDGEKSLFTIGALPHKKNGVPDLSQTTSNDSPDGHGSNNERDKKRRRVSQSKTFKVEISFPAKIPLPAIAAALHGQESQNSREAFRVLDIILRQHAAKQMNLGVSLTLEVVFLDLGCWGFHSSFQATQGGLSLNIDGSTTSIIKPGPLVDFLIANQNVHDCYQLHWAKAKRTLKNLRIRVHPFNREYRITGLSDSTCKRQMFSWKSGVKDRNGDVKCVDVTVFDYFVNHGRINLCFSGDFPCIDVGKPRKPTYIPIEPCSLLSLQRYTKALTVFQRSALVEKSQQKPQEKMKIITDVMRSNKYDSEPMLRSCAISINSRFAKVEGRILSAPRGAYHPKNGRWSFHNKIFVQAAKIDHWAVVNFSARYDIRSLCRDLIRFGEMKGIVTPVRADRMFVQMKQKFEKCPCFLLCLLPDKKDSDLYGSWKRKTLSEFGIFNQCLAPTKVNEHDLMNVLLKINANCQRELTDPLILLGGLNSLLAIEQSKNLPLVSKVPTIIFGMDVSHGSPGHSNVPSVATVGCNSFSRNWPILSRYRASVRSQSAKLEMTDSLFKPLPNKDDAAIVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein argonaute 4 Involved in transcriptional gene silencing (TGS). Component of the RISC complex that associate with the small interfering RNA (siRNA) pathway involved in direct cytosine methylation at endogenous DNA repeats. Forms a AGO4/NRPE1/siRNA complex in cajal body, facilitating its function in RNA-directed gene silencing of target loci. Required for CpNpG and asymmetric DNA methylation as well as histone H3 'Lys-9' methylation (H3K9me) at SUP and SN1 loci. May be not required for CpG methylation. Required for the production and maintenance of retrotransposon SN1 and Copia and ribosomal 5S 25 nucleotide siRNAs specialized in gene silencing at chromatin level. Involved in de novo methylation of FWA gene and required for the maintenance of RNA-directed DNA methylation (RdDM) triggered by inverted repeat transgenes. Interacts with miRNA miR390 and miR172, targeting respectively TAS3 and AP2 mRNAs, and mediates cleavage of miRNA targets. Associates mainly with small RNAs of 24 nucleotide in length and preferentially recruits small RNAs with a 5' terminal adenosine. Targeted by the turnip yellows virus (TuYV) protein P0 (via F-box-like domain) for probable proteasome degradation and thereby inactivating AGO4 function in RNA silencing. Required for resistance to the bacterial pathogen P.syringae. Works independently of the RdDM pathway in mediating resistance to P.syringae. RdDM is involved in viral genome methylation as an epigenetic defense against geminiviruses.probableQ9ZVD5
Protein argonaute 4B Probably involved in the RNA silencing pathway. May bind to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them.probableQ0JF58

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3T, chain A
Confidence level:very confident
Coverage over the Query: 2-81,108-515,527-611
View the alignment between query and template
View the model in PyMOL
Template: 4F1N, chain A
Confidence level:very confident
Coverage over the Query: 2-76,106-256,276-515,527-611
View the alignment between query and template
View the model in PyMOL