Citrus Sinensis ID: 036177


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MQSKSQCSLIFLLKKLRATDIDECLDKEKYHCEGKCKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIVAGCVVVLGLLFLLPIGLWRWYKFIKRRRKIKRKQKFFKRNGGLLLRQELSSNEGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG
ccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccHHHHHHHHcccccccccccccccEEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEEEcccc
cccccccccccccccccccccHHcccccccccccEEEcccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHEEEcccccccccEEEEcHHHHHHHHcccccccEEccccccEEEEEEcccccEEEEEEcEEEcHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccccEEEEEEcccc
MQSKSQCSLIFLLKKLRatdidecldkekyhcegkckntigsytcdcpigmygdgkvgcrGFRIITIVAGCVVVLGLLFLLPIGLWRWYKFIKRRRKIKRKQKFFKRNGGLLLRQElssnegniektklftskdlekatdnykvsriigqggqgtvfkgmltdgRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG
MQSKSQCSLIFLLKKLRATDIDECLDKekyhcegkckntigsytcdCPIGMYGDGKVGCRGFRIITIVAGCVVVLGLLFLLPIGLWRWYKFIKrrrkikrkqkffkrngglllrqelssnegniektklftskdlekatdnykvsriigqggqgtvfkGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG
MQSKSQCSLIFLLKKLRATDIDECLDKEKYHCEGKCKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIvagcvvvlgllfllpiglWRWYkfikrrrkikrkqkffkrNGGLLLRQELSSNEGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG
******CSLIFLLKKLRATDIDECLDKEKYHCEGKCKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIVAGCVVVLGLLFLLPIGLWRWYKFIKRRRKIKRKQKFFKRNGGLLLR**********************KATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIL**
*********IFLLKKLRATDIDECLDKEKYHCEGKCKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIVAGCVVVLGLLFLLPIGLWRWYKFIK**********************************KLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSV***NVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG
MQSKSQCSLIFLLKKLRATDIDECLDKEKYHCEGKCKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIVAGCVVVLGLLFLLPIGLWRWYKFIKRRRKIKRKQKFFKRNGGLLLRQELSSNEGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG
MQSKSQCSLIFLLKKLRATDIDECLDKEKYHCEGKCKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIVAGCVVVLGLLFLLPIGLWRWYKFIKRRRKIKRKQKFFKRNGGLLLRQELSSNEGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILN*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSKSQCSLIFLLKKLRATDIDECLDKEKYHCEGKCKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIVAGCVVVLGLLFLLPIGLWRWYKFIKRRRKIKRKQKFFKRNGGLLLRQELSSNEGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query221 2.2.26 [Sep-21-2011]
Q7X8C5 748 Wall-associated receptor no no 0.859 0.254 0.524 8e-55
Q9S9M2 761 Wall-associated receptor yes no 0.859 0.249 0.539 1e-54
Q8GXQ3 642 Wall-associated receptor no no 0.855 0.294 0.532 1e-54
Q9C9L5 792 Wall-associated receptor no no 0.846 0.236 0.553 9e-54
Q9LMT9 764 Putative wall-associated no no 0.859 0.248 0.546 2e-53
Q9S9M5 730 Wall-associated receptor no no 0.855 0.258 0.526 2e-53
Q9LN59 788 Putative wall-associated no no 0.864 0.242 0.596 7e-53
Q8VYA3 769 Wall-associated receptor no no 0.846 0.243 0.546 2e-52
Q8RY17 751 Wall-associated receptor no no 0.859 0.252 0.563 9e-52
Q9SA25 720 Wall-associated receptor no no 0.832 0.255 0.529 5e-51
>sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1 Back     alignment and function desciption
 Score =  213 bits (542), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 150/204 (73%), Gaps = 14/204 (6%)

Query: 20  DIDEC-LDKEKYHCEGK-CKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIVAGCVVVLGL 77
           D+DEC LD  +  C+ + C N  G + C              +  ++  ++ G V++   
Sbjct: 304 DVDECKLDIGRNQCKDQSCVNLPGWFDCQPK-----------KPEQLKRVIQG-VLIGSA 351

Query: 78  LFLLPIGLWRWYKFIKRRRKIKRKQKFFKRNGGLLLRQELSSNEGNIEKTKLFTSKDLEK 137
           L L   G++  YKF+++RRK+ R +KFF+RNGG+LL+Q+L+  EGN+E +++F+S +LEK
Sbjct: 352 LLLFAFGIFGLYKFVQKRRKLIRMRKFFRRNGGMLLKQQLARKEGNVEMSRIFSSHELEK 411

Query: 138 ATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRN 197
           ATDN+  +R++GQGGQGTV+KGML DGRIVAVK+SK+V E  VE+FINEVV+L+QINHRN
Sbjct: 412 ATDNFNKNRVLGQGGQGTVYKGMLVDGRIVAVKRSKAVDEDRVEEFINEVVVLAQINHRN 471

Query: 198 VVKLLGCCLETEVPLLVYEFILNG 221
           +VKLLGCCLETEVP+LVYEF+ NG
Sbjct: 472 IVKLLGCCLETEVPVLVYEFVPNG 495




Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=Arabidopsis thaliana GN=WAKL4 PE=2 SV=2 Back     alignment and function description
>sp|Q8GXQ3|WAKLF_ARATH Wall-associated receptor kinase-like 6 OS=Arabidopsis thaliana GN=WAKL6 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9L5|WAKLH_ARATH Wall-associated receptor kinase-like 9 OS=Arabidopsis thaliana GN=WAKL9 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMT9|WAKLL_ARATH Putative wall-associated receptor kinase-like 13 OS=Arabidopsis thaliana GN=WAKL13 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1 OS=Arabidopsis thaliana GN=WAKL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LN59|WAKLK_ARATH Putative wall-associated receptor kinase-like 11 OS=Arabidopsis thaliana GN=WAKL11 PE=3 SV=2 Back     alignment and function description
>sp|Q8VYA3|WAKLJ_ARATH Wall-associated receptor kinase-like 10 OS=Arabidopsis thaliana GN=WAKL10 PE=2 SV=1 Back     alignment and function description
>sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1 Back     alignment and function description
>sp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana GN=WAKL8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
225459920 736 PREDICTED: wall-associated receptor kina 0.909 0.273 0.608 1e-66
297734736 898 unnamed protein product [Vitis vinifera] 0.909 0.223 0.608 2e-66
147770821 724 hypothetical protein VITISV_023562 [Viti 0.909 0.277 0.603 5e-66
224075946 729 predicted protein [Populus trichocarpa] 0.864 0.262 0.596 3e-58
449455742 738 PREDICTED: wall-associated receptor kina 0.895 0.268 0.559 4e-58
449485245 717 PREDICTED: wall-associated receptor kina 0.895 0.276 0.559 5e-58
255545824 727 kinase, putative [Ricinus communis] gi|2 0.904 0.275 0.623 7e-58
255545828 694 kinase, putative [Ricinus communis] gi|2 0.914 0.291 0.566 1e-57
255541802 743 kinase, putative [Ricinus communis] gi|2 0.904 0.269 0.615 3e-57
359492355 745 PREDICTED: wall-associated receptor kina 0.909 0.269 0.561 8e-57
>gi|225459920|ref|XP_002264469.1| PREDICTED: wall-associated receptor kinase-like 8-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 155/202 (76%), Gaps = 1/202 (0%)

Query: 20  DIDECLDKEKYHCEGKCKNTIGSYTCDCPIGMYGDGKVGCRGFRIITIVAGCVVVLGLLF 79
           DIDEC +   Y CEG C+NT+G+Y+C CP GM+G+GKV CRG    T+  G  + LG L 
Sbjct: 280 DIDECSEPNIYQCEGICRNTVGNYSCRCPFGMHGEGKVACRGHHTATVFLGIGLSLGFLL 339

Query: 80  LLPIGLWRWYKFIKRRRKIKRKQKFFKRNGGLLLRQELSSNEGNIEKTKLFTSKDLEKAT 139
            L  GL+R Y  +  +  IK K+KFFKRNGGLLL Q++SS++G +EK K FTS++LEKAT
Sbjct: 340 ALS-GLFRLYLLVHEQNSIKLKRKFFKRNGGLLLEQQISSDKGKLEKIKNFTSEELEKAT 398

Query: 140 DNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVV 199
           D+Y  +RI+GQGGQG V+K ML DG +VAVKKS+ + E  +E F+NEVVILSQINHR+VV
Sbjct: 399 DHYNDNRILGQGGQGIVYKAMLPDGNLVAVKKSEMMDEGQIEHFVNEVVILSQINHRHVV 458

Query: 200 KLLGCCLETEVPLLVYEFILNG 221
           KLLGCCLETEVPLLVYE++ NG
Sbjct: 459 KLLGCCLETEVPLLVYEYVSNG 480




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297734736|emb|CBI16970.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770821|emb|CAN76425.1| hypothetical protein VITISV_023562 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224075946|ref|XP_002304841.1| predicted protein [Populus trichocarpa] gi|222842273|gb|EEE79820.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449455742|ref|XP_004145610.1| PREDICTED: wall-associated receptor kinase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449485245|ref|XP_004157111.1| PREDICTED: wall-associated receptor kinase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255545824|ref|XP_002513972.1| kinase, putative [Ricinus communis] gi|223547058|gb|EEF48555.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255545828|ref|XP_002513974.1| kinase, putative [Ricinus communis] gi|223547060|gb|EEF48557.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255541802|ref|XP_002511965.1| kinase, putative [Ricinus communis] gi|223549145|gb|EEF50634.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359492355|ref|XP_002284688.2| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
TAIR|locus:2019843 769 WAKL10 "WALL ASSOCIATED KINASE 0.515 0.148 0.719 2.1e-46
TAIR|locus:2200527 642 WAKL6 "wall associated kinase- 0.515 0.177 0.684 3e-45
TAIR|locus:2032875 720 AT1G16260 [Arabidopsis thalian 0.511 0.156 0.699 4.9e-45
TAIR|locus:2126316 786 AT4G31100 [Arabidopsis thalian 0.515 0.145 0.710 1.1e-44
TAIR|locus:2126271 793 AT4G31110 [Arabidopsis thalian 0.515 0.143 0.710 8.6e-44
TAIR|locus:2019893 751 RFO1 "RESISTANCE TO FUSARIUM O 0.515 0.151 0.692 1.1e-43
TAIR|locus:2016377 788 AT1G19390 [Arabidopsis thalian 0.515 0.144 0.763 5.1e-43
TAIR|locus:2200562 748 WAKL2 "wall associated kinase- 0.515 0.152 0.701 1e-41
TAIR|locus:2200552 730 WAKL1 "wall associated kinase- 0.515 0.156 0.692 1.9e-41
TAIR|locus:2030988 764 AT1G17910 [Arabidopsis thalian 0.515 0.149 0.728 2.5e-41
TAIR|locus:2019843 WAKL10 "WALL ASSOCIATED KINASE (WAK)-LIKE 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 451 (163.8 bits), Expect = 2.1e-46, Sum P(2) = 2.1e-46
 Identities = 82/114 (71%), Positives = 104/114 (91%)

Query:   108 NGGLLLRQELSSNEGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIV 167
             NGGLLL+Q+L++ EGN++ T++F S++LEKAT+N+ ++RI+G+GGQGTV+KGML DGRIV
Sbjct:   399 NGGLLLQQQLTTTEGNVDSTRVFNSRELEKATENFSLTRILGEGGQGTVYKGMLVDGRIV 458

Query:   168 AVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG 221
             AVKKSK V E  +E+FINEVVILSQINHRN+VKLLGCCLET+VP+LVYEFI NG
Sbjct:   459 AVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETDVPILVYEFIPNG 512


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0004383 "guanylate cyclase activity" evidence=IDA
GO:0006182 "cGMP biosynthetic process" evidence=IDA
GO:0006952 "defense response" evidence=IEP
GO:0009617 "response to bacterium" evidence=IEP
GO:0009620 "response to fungus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=RCA
TAIR|locus:2200527 WAKL6 "wall associated kinase-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032875 AT1G16260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126316 AT4G31100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126271 AT4G31110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019893 RFO1 "RESISTANCE TO FUSARIUM OXYSPORUM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016377 AT1G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200562 WAKL2 "wall associated kinase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200552 WAKL1 "wall associated kinase-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030988 AT1G17910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-16
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 2e-16
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-16
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-15
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-14
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 4e-14
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 5e-13
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 2e-12
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-12
cd05049 280 cd05049, PTKc_Trk, Catalytic domain of the Protein 8e-11
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-10
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-10
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-09
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-09
cd05058 262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 6e-09
cd05118 283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 9e-09
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-08
cd05085 250 cd05085, PTKc_Fer, Catalytic domain of the Protein 3e-08
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 4e-08
cd05039 256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 6e-08
cd06631 265 cd06631, STKc_YSK4, Catalytic domain of the Protei 8e-08
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 1e-07
cd08224 267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-07
cd07829 282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-07
cd05035 273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 2e-07
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-07
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 2e-07
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 2e-07
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-07
cd05044 269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 3e-07
cd05084 252 cd05084, PTKc_Fes, Catalytic domain of the Protein 3e-07
cd05036 277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 5e-07
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 5e-07
cd05112 256 cd05112, PTKc_Itk, Catalytic domain of the Protein 8e-07
cd05050 288 cd05050, PTKc_Musk, Catalytic domain of the Protei 1e-06
cd05048 283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 1e-06
cd05033 266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 1e-06
cd08215 258 cd08215, STKc_Nek, Catalytic domain of the Protein 1e-06
cd07832 286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-06
cd08217 265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-06
cd05032 277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 4e-06
cd05056 270 cd05056, PTKc_FAK, Catalytic domain of the Protein 4e-06
cd05092 280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 5e-06
cd05063 268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 5e-06
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 6e-06
cd06626 264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 6e-06
cd06607 307 cd06607, STKc_TAO, Catalytic domain of the Protein 8e-06
cd05060 257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 8e-06
cd05046 275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 8e-06
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-05
cd07864 302 cd07864, STKc_CDK12, Catalytic domain of the Serin 1e-05
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-05
cd05106 374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 2e-05
cd05052 263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-05
cd05093 288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 2e-05
cd05082 256 cd05082, PTKc_Csk, Catalytic domain of the Protein 2e-05
cd05059 256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 2e-05
cd06612 256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-05
cd07865 310 cd07865, STKc_CDK9, Catalytic domain of the Serine 2e-05
cd05075 272 cd05075, PTKc_Axl, Catalytic domain of the Protein 2e-05
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 3e-05
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-05
cd06648 285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 3e-05
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 5e-05
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 5e-05
cd05083 254 cd05083, PTKc_Chk, Catalytic domain of the Protein 5e-05
cd07860 284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 6e-05
cd05148 261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 6e-05
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 6e-05
cd07835 283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 6e-05
cd06613 262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 7e-05
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 8e-05
cd06657 292 cd06657, STKc_PAK4, Catalytic domain of the Protei 8e-05
cd05123 250 cd05123, STKc_AGC, Catalytic domain of AGC family 9e-05
cd05034 261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 9e-05
cd06647 293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-04
cd06632 258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-04
cd06610 267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 1e-04
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 1e-04
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 1e-04
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN00034 353 PLN00034, PLN00034, mitogen-activated protein kina 2e-04
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-04
cd05104 375 cd05104, PTKc_Kit, Catalytic domain of the Protein 2e-04
cd05074 273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 2e-04
cd05097 295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 2e-04
cd06628 267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-04
cd06634 308 cd06634, STKc_TAO2, Catalytic domain of the Protei 2e-04
cd06655 296 cd06655, STKc_PAK2, Catalytic domain of the Protei 2e-04
cd06624 268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-04
pfam1294736 pfam12947, EGF_3, EGF domain 3e-04
cd05066 267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-04
cd07846 286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 4e-04
cd05042 269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 4e-04
cd05062 277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 4e-04
cd07837 295 cd07837, STKc_CdkB_plant, Catalytic domain of the 4e-04
cd06633 313 cd06633, STKc_TAO3, Catalytic domain of the Protei 5e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 5e-04
cd05078 258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 5e-04
cd06635 317 cd06635, STKc_TAO1, Catalytic domain of the Protei 5e-04
cd05094 291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 5e-04
cd05055 302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 5e-04
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 5e-04
cd05053 293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 8e-04
cd06654 296 cd06654, STKc_PAK1, Catalytic domain of the Protei 9e-04
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 0.001
cd06656 297 cd06656, STKc_PAK3, Catalytic domain of the Protei 0.001
cd08530 256 cd08530, STKc_CNK2-like, Catalytic domain of the P 0.001
cd05068 261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 0.001
cd07854 342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 0.001
smart0018135 smart00181, EGF, Epidermal growth factor-like doma 0.001
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 0.001
cd05090 283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 0.002
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 0.002
cd06608 275 cd06608, STKc_myosinIII_like, Catalytic domain of 0.002
cd07843 293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 0.002
cd05064 266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 0.002
cd05578 258 cd05578, STKc_Yank1, Catalytic domain of the Prote 0.003
cd05054 337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 0.003
cd08529 256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 0.003
cd07836 284 cd07836, STKc_Pho85, Catalytic domain of the Serin 0.003
cd05109 279 cd05109, PTKc_HER2, Catalytic domain of the Protei 0.003
cd06917 277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 0.003
cd05061 288 cd05061, PTKc_InsR, Catalytic domain of the Protei 0.004
cd06644 292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 0.004
cd05081 284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 0.004
cd05116 257 cd05116, PTKc_Syk, Catalytic domain of the Protein 0.004
cd05102 338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 0.004
cd05096 304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 0.004
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
 Score = 76.0 bits (188), Expect = 1e-16
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 143 KVSRIIGQGGQGTVFKGMLTD-----GRIVAVKKSKSVH-ESNVEQFINEVVILSQINHR 196
            + + +G+G  G V+KG L          VAVK  K    E  +E+F+ E  I+ +++H 
Sbjct: 2   TLGKKLGEGAFGEVYKGKLKGKGGKKKVEVAVKTLKEDASEQQIEEFLREARIMRKLDHP 61

Query: 197 NVVKLLGCCLETEVPLLVYEFILNG 221
           NVVKLLG C E E   +V E++  G
Sbjct: 62  NVVKLLGVCTEEEPLYIVMEYMEGG 86


Phosphotransferases. Tyrosine-specific kinase subfamily. Length = 257

>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|205157 pfam12947, EGF_3, EGF domain Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|214544 smart00181, EGF, Epidermal growth factor-like domain Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 221
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.82
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.81
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 99.81
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.79
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 99.79
KOG3653 534 consensus Transforming growth factor beta/activin 99.74
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 99.74
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.73
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 99.71
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.68
KOG0192 362 consensus Tyrosine kinase specific for activated ( 99.68
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.66
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.64
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.57
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.54
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.53
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.51
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.48
KOG0605 550 consensus NDR and related serine/threonine kinases 99.47
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 99.46
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.46
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.45
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.43
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.43
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.43
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.42
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.42
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 99.41
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.4
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 99.4
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.37
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.36
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 99.36
PHA02988 283 hypothetical protein; Provisional 99.36
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.36
KOG0598 357 consensus Ribosomal protein S6 kinase and related 99.36
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.35
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.35
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.35
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.35
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.34
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.34
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 99.34
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.34
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.33
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.33
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.33
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.33
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.33
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.33
KOG0586 596 consensus Serine/threonine protein kinase [General 99.32
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.32
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.32
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.32
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.31
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.31
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.31
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.31
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.31
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.31
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.3
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.3
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.29
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.29
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.29
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.29
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.29
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.28
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.28
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.28
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.28
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 99.28
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.28
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.28
KOG0198 313 consensus MEKK and related serine/threonine protei 99.27
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.27
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.27
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.27
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.27
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.27
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.27
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.27
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.26
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.26
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.26
KOG0578 550 consensus p21-activated serine/threonine protein k 99.26
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.26
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.25
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.25
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.25
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.25
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.25
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.25
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.25
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.25
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.25
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.25
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.25
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.24
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.24
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.24
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.24
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.24
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.24
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.24
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.23
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.23
PTZ00267 478 NIMA-related protein kinase; Provisional 99.23
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.23
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.23
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.23
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.23
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.22
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.22
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.22
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 99.22
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.22
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.22
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.22
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.22
KOG0583 370 consensus Serine/threonine protein kinase [Signal 99.22
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.21
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.21
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.21
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.21
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.21
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.21
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.21
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.21
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.21
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.2
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.2
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.2
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.2
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.2
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.2
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.19
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.19
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.19
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.19
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.19
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.19
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.19
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.19
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.19
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.19
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.19
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.19
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.18
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.18
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.18
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.18
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.18
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.18
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.18
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.18
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.18
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.17
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.17
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.17
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.17
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.17
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.17
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.17
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.17
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 99.17
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.17
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.17
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.17
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.17
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.17
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.16
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.16
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.16
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.16
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.15
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.15
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.15
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.15
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.15
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 99.15
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.14
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.14
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.14
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.14
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.14
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.14
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.14
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.14
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.14
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.14
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.14
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.14
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.14
PLN00009 294 cyclin-dependent kinase A; Provisional 99.13
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.13
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.13
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.13
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.13
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.13
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.13
PRK09188 365 serine/threonine protein kinase; Provisional 99.13
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.13
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.13
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.13
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.13
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.13
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.13
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.12
KOG0694 694 consensus Serine/threonine protein kinase [Signal 99.12
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.12
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.12
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.12
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.12
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.12
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.11
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.11
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.11
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.11
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.11
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.11
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.11
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.11
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.11
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.1
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.1
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.1
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.1
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.1
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.1
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.1
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.1
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.1
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.1
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.09
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.09
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.09
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.09
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.09
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.09
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.09
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.09
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.09
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.09
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.08
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.08
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 99.08
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.08
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.08
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.08
PHA03212 391 serine/threonine kinase US3; Provisional 99.08
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.07
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.07
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.07
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.06
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.06
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.06
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.06
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.06
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.06
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.06
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.06
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.05
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.05
KOG0610 459 consensus Putative serine/threonine protein kinase 99.05
PTZ00283 496 serine/threonine protein kinase; Provisional 99.05
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.05
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.05
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.05
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.05
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.05
PTZ00036 440 glycogen synthase kinase; Provisional 99.05
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.05
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.04
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.04
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.03
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.03
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.03
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.03
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.03
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.02
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.02
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.02
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 99.02
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.02
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.02
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.01
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 99.01
KOG0589 426 consensus Serine/threonine protein kinase [General 99.01
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.01
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.01
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.01
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.0
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.0
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.0
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.0
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.0
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.0
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 99.0
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 98.99
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 98.99
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.99
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 98.98
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 98.98
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 98.98
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.98
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.97
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 98.97
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 98.97
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 98.97
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 98.97
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.97
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 98.97
PTZ00024 335 cyclin-dependent protein kinase; Provisional 98.97
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.96
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 98.96
PHA03211 461 serine/threonine kinase US3; Provisional 98.96
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 98.96
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.96
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 98.95
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.95
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 98.95
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 98.95
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.94
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 98.94
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 98.94
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.93
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.93
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 98.93
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 98.92
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 98.91
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 98.91
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.91
PHA03209 357 serine/threonine kinase US3; Provisional 98.9
KOG4717 864 consensus Serine/threonine protein kinase [Signal 98.9
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.9
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.88
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.88
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 98.88
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.88
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.87
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 98.86
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 98.86
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 98.85
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.85
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 98.85
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 98.85
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 98.85
PHA03207 392 serine/threonine kinase US3; Provisional 98.84
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 98.84
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 98.83
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.83
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 98.81
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.81
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.8
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 98.79
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 98.78
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 98.78
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 98.76
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 98.76
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.75
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 98.75
KOG0607 463 consensus MAP kinase-interacting kinase and relate 98.74
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 98.74
PRK10345 210 hypothetical protein; Provisional 98.74
PHA03210 501 serine/threonine kinase US3; Provisional 98.71
KOG0584 632 consensus Serine/threonine protein kinase [General 98.71
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 98.71
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 98.71
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.69
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 98.68
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 98.68
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 98.68
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 98.68
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 98.65
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.65
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 98.62
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 98.61
cd00180 215 PKc Catalytic domain of Protein Kinases. Protein K 98.61
PRK14879 211 serine/threonine protein kinase; Provisional 98.6
TIGR03724 199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.58
KOG0690 516 consensus Serine/threonine protein kinase [Signal 98.58
PRK10359 232 lipopolysaccharide core biosynthesis protein; Prov 98.57
KOG0596 677 consensus Dual specificity; serine/threonine and t 98.57
PTZ00284 467 protein kinase; Provisional 98.57
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 98.51
PRK09605 535 bifunctional UGMP family protein/serine/threonine 98.46
KOG1152 772 consensus Signal transduction serine/threonine kin 98.4
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 98.4
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 98.33
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.29
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 98.29
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.24
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.24
KOG1027 903 consensus Serine/threonine protein kinase and endo 98.23
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 98.16
KOG0984 282 consensus Mitogen-activated protein kinase (MAPK) 98.14
smart00090 237 RIO RIO-like kinase. 98.11
KOG0695 593 consensus Serine/threonine protein kinase [Signal 98.11
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 98.09
KOG1290 590 consensus Serine/threonine protein kinase [Signal 98.05
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 98.05
KOG1167 418 consensus Serine/threonine protein kinase of the C 98.04
KOG0696 683 consensus Serine/threonine protein kinase [Signal 98.04
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 98.04
PHA02882 294 putative serine/threonine kinase; Provisional 98.04
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.03
KOG1219 4289 consensus Uncharacterized conserved protein, conta 97.98
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.96
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 97.92
PHA03099139 epidermal growth factor-like protein (EGF-like pro 97.88
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 97.84
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 97.81
KOG4260350 consensus Uncharacterized conserved protein [Funct 97.74
PRK12274 218 serine/threonine protein kinase; Provisional 97.73
COG0515 384 SPS1 Serine/threonine protein kinase [General func 97.68
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 97.65
KOG1214 1289 consensus Nidogen and related basement membrane pr 97.61
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 97.6
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 97.51
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.49
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 97.45
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 97.41
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 97.38
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 97.28
cd05154 223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 97.24
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 97.23
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.16
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 97.1
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.08
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 97.05
PRK01723 239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 97.03
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 96.9
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 96.75
COG2112 201 Predicted Ser/Thr protein kinase [Signal transduct 96.72
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 96.34
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.3
PF12191129 stn_TNFRSF12A: Tumour necrosis factor receptor stn 96.23
KOG1219 4289 consensus Uncharacterized conserved protein, conta 96.2
PF1266224 cEGF: Complement Clr-like EGF-like 96.08
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.03
COG0661 517 AarF Predicted unusual protein kinase [General fun 95.86
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 95.83
cd0005336 EGF Epidermal growth factor domain, found in epide 95.53
KOG1243 690 consensus Protein kinase [General function predict 95.53
KOG1214 1289 consensus Nidogen and related basement membrane pr 95.45
KOG42581025 consensus Insulin/growth factor receptor (contains 95.32
smart0018135 EGF Epidermal growth factor-like domain. 94.94
PLN02876 822 acyl-CoA dehydrogenase 94.89
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 94.87
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 94.55
PRK10593 297 hypothetical protein; Provisional 94.28
PF02009299 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR00 94.26
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 93.75
KOG1235 538 consensus Predicted unusual protein kinase [Genera 93.63
KOG1033 516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 93.56
PRK09550 401 mtnK methylthioribose kinase; Reviewed 93.34
COG0478 304 RIO-like serine/threonine protein kinase fused to 92.88
PTZ00046358 rifin; Provisional 92.65
TIGR01477353 RIFIN variant surface antigen, rifin family. This 92.53
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 92.42
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 92.37
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 92.31
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 92.14
PF01636 239 APH: Phosphotransferase enzyme family This family 91.97
PF03881 288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 91.92
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 91.56
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 91.5
TIGR02172 226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 91.43
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 91.34
cd05150 244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 91.22
KOG3087 229 consensus Serine/threonine protein kinase [General 91.06
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 90.99
COG3642 204 Mn2+-dependent serine/threonine protein kinase [Si 90.88
PF03302397 VSP: Giardia variant-specific surface protein; Int 90.16
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 90.15
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 89.08
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 88.11
PF0811443 PMP1_2: ATPase proteolipid family; InterPro: IPR01 87.63
KOG1226783 consensus Integrin beta subunit (N-terminal portio 87.35
PF15102146 TMEM154: TMEM154 protein family 87.25
PHA02887126 EGF-like protein; Provisional 87.04
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 86.52
PF0811443 PMP1_2: ATPase proteolipid family; InterPro: IPR01 85.88
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 85.72
PF08374221 Protocadherin: Protocadherin; InterPro: IPR013585 84.29
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 83.96
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 82.82
KOG4260350 consensus Uncharacterized conserved protein [Funct 82.41
KOG1217487 consensus Fibrillins and related proteins containi 82.11
KOG0590 601 consensus Checkpoint kinase and related serine/thr 82.0
PF00954110 S_locus_glycop: S-locus glycoprotein family; Inter 80.6
COG3001 286 Uncharacterized protein conserved in bacteria [Fun 80.56
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 80.55
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.82  E-value=7.3e-20  Score=144.72  Aligned_cols=96  Identities=50%  Similarity=0.825  Sum_probs=86.7

Q ss_pred             ceeeechhhhhhhccCccccceecccCceEEEEEEeCCCcEEEEEeccCCCcccHHHHHHHHHHHHcCCCCceeeeeeEE
Q 036177          126 KTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCC  205 (221)
Q Consensus       126 ~~~~~~~~~~~~~~~~~~~~~~lg~G~fg~v~~~~~~~~~~vavk~~~~~~~~~~~~~~~e~~~l~~l~h~niv~l~g~~  205 (221)
                      ....|+++++..++++|...+.||+|+||.||+|.+.++..||||++.....+...+|.+|+.+|.+++|||+|+|+|+|
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~~~vAVK~~~~~~~~~~~eF~~Ei~~ls~l~H~Nlv~LlGyC  140 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDGTVVAVKRLSSNSGQGEREFLNEVEILSRLRHPNLVKLLGYC  140 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCCCEEEEEEecCCCCcchhHHHHHHHHHhcCCCcCcccEEEEE
Confidence            56679999999999999999999999999999999988899999988764433145699999999999999999999999


Q ss_pred             EeCC-eeEEEEEcccCC
Q 036177          206 LETE-VPLLVYEFILNG  221 (221)
Q Consensus       206 ~~~~-~~~lv~e~~~~G  221 (221)
                      ...+ ..+||||||++|
T Consensus       141 ~e~~~~~~LVYEym~nG  157 (361)
T KOG1187|consen  141 LEGGEHRLLVYEYMPNG  157 (361)
T ss_pred             ecCCceEEEEEEccCCC
Confidence            9988 599999999998



>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF12191 stn_TNFRSF12A: Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain; InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG4258 consensus Insulin/growth factor receptor (contains protein kinase domain) [Signal transduction mechanisms] Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PF02009 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00046 rifin; Provisional Back     alignment and domain information
>TIGR01477 RIFIN variant surface antigen, rifin family Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>PF08114 PMP1_2: ATPase proteolipid family; InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase Back     alignment and domain information
>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08114 PMP1_2: ATPase proteolipid family; InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 2e-14
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 2e-14
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 4e-08
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 4e-08
3bkb_A 377 Crystal Structure Of Human Feline Sarcoma Viral Onc 3e-06
3cd3_A 377 Crystal Structure Of Phosphorylated Human Feline Sa 3e-06
4gt5_A 306 Crystal Structure Of The Inactive Trka Kinase Domai 8e-06
4f0i_A 300 Crystal Structure Of Apo Trka Length = 300 8e-06
4aoj_A 329 Human Trka In Complex With The Inhibitor Az-23 Leng 9e-06
3f66_A 298 Human C-Met Kinase In Complex With Quinoxaline Inhi 1e-05
2g15_A 318 Structural Characterization Of Autoinhibited C-Met 1e-05
3q6u_A 308 Structure Of The Apo Met Receptor Kinase In The Dua 1e-05
2rfn_A 310 X-ray Structure Of C-met With Inhibitor. Length = 3 1e-05
3lq8_A 302 Structure Of The Kinase Domain Of C-Met Bound To Xl 1e-05
4gg5_A 319 Crystal Structure Of Cmet In Complex With Novel Inh 1e-05
2wgj_A 306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 1e-05
2wd1_A 292 Human C-Met Kinase In Complex With Azaindole Inhibi 1e-05
3c1x_A 373 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-05
3q6w_A 307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-05
3i5n_A 309 Crystal Structure Of C-Met With Triazolopyridazine 1e-05
3a4p_A 319 Human C-Met Kinase Domain Complexed With 6-Benzylox 1e-05
3qti_A 314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 1e-05
3cth_A 314 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-05
3dkg_A 317 Sgx Clone 5698a109kfg1h1 Length = 317 1e-05
1r0p_A 312 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-05
3dkc_A 317 Sgx Clone 5698a65kfg1h1 Length = 317 1e-05
4f0f_A 287 Crystal Structure Of The Roco4 Kinase Domain Bound 2e-05
4f1o_A 287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 2e-05
4f1m_A 287 Crystal Structure Of The G1179s Roco4 Kinase Domain 2e-05
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 2e-05
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 2e-05
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 2e-05
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 3e-05
2r4b_A 321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 4e-05
1fpu_A 293 Crystal Structure Of Abl Kinase Domain In Complex W 4e-05
2z60_A 288 Crystal Structure Of The T315i Mutant Of Abl Kinase 4e-05
3oy3_A 284 Crystal Structure Of Abl T315i Mutant Kinase Domain 5e-05
2qoh_A 288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 5e-05
3qri_A 277 The Crystal Structure Of Human Abl1 Kinase Domain I 5e-05
3dk7_A 277 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-05
3qrj_A 277 The Crystal Structure Of Human Abl1 Kinase Domain T 5e-05
2v7a_A 286 Crystal Structure Of The T315i Abl Mutant In Comple 5e-05
2e2b_A 293 Crystal Structure Of The C-Abl Kinase Domain In Com 5e-05
2f4j_A 287 Structure Of The Kinase Domain Of An Imatinib-Resis 5e-05
2hzi_A 277 Abl Kinase Domain In Complex With Pd180970 Length = 5e-05
2gqg_A 278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 5e-05
2g2f_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 5e-05
3dk3_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-05
2hiw_A 287 Crystal Structure Of Inactive Conformation Abl Kina 5e-05
2hz0_A 270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 5e-05
2g1t_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 5e-05
3oxz_A 284 Crystal Structure Of Abl Kinase Domain Bound With A 5e-05
2hyy_A 273 Human Abl Kinase Domain In Complex With Imatinib (S 5e-05
3pyy_A 298 Discovery And Characterization Of A Cell-Permeable, 5e-05
3fzo_A 277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 6e-05
3cc6_A 281 Crystal Structure Of Kinase Domain Of Protein Tyros 7e-05
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 7e-05
4h1j_A 293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 7e-05
3qup_A 323 Inhibitor Bound Structure Of The Kinase Domain Of T 7e-05
2eva_A 307 Structural Basis For The Interaction Of Tak1 Kinase 7e-05
4gs6_A 315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 8e-05
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 8e-05
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-05
3dk6_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 8e-05
4asz_A 299 Crystal Structure Of Apo Trkb Kinase Domain Length 1e-04
2p0c_A 313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 1e-04
2zm3_A 308 Complex Structure Of Insulin-Like Growth Factor Rec 1e-04
1jqh_A 308 Igf-1 Receptor Kinase Domain Length = 308 1e-04
2jkk_A 276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-04
2jkm_A 276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-04
3o23_A 305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 2e-04
2j0l_A 276 Crystal Structure Of A The Active Conformation Of T 2e-04
2j0m_B 276 Crystal Structure A Two-Chain Complex Between The F 2e-04
4ebw_A 304 Structure Of Focal Adhesion Kinase Catalytic Domain 2e-04
1mp8_A 281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 2e-04
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 2e-04
3niz_A 311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-04
2etm_A 281 Crystal Structure Of Focal Adhesion Kinase Domain C 2e-04
3pxk_A 282 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-04
1p4o_A 322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 2e-04
4aaa_A 331 Crystal Structure Of The Human Cdkl2 Kinase Domain 2e-04
1m7n_A 322 Crystal Structure Of Unactivated Apo Insulin-Like G 2e-04
2qkr_A 313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-04
3lvp_A 336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 2e-04
4hct_A 269 Crystal Structure Of Itk In Complex With Compound 5 3e-04
1jpa_A 312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 3e-04
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 3e-04
3v5j_A 266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-04
2j0j_A 656 Crystal Structure Of A Fragment Of Focal Adhesion K 3e-04
2j0k_A 656 Crystal Structure Of A Fragment Of Focal Adhesion K 3e-04
3miy_A 266 X-Ray Crystal Structure Of Itk Complexed With Sunit 3e-04
1sm2_A 264 Crystal Structure Of The Phosphorylated Interleukin 3e-04
2oj9_A 307 Structure Of Igf-1r Kinase Domain Complexed With A 3e-04
2hen_A 286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 3e-04
3rp9_A 458 Crystal Structure Of The Apo Mapk From Toxoplasma G 4e-04
3i81_A 315 Crystal Structure Of Insulin-Like Growth Factor 1 R 4e-04
1luf_A 343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 4e-04
4eok_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 4e-04
4eoi_A 299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 4e-04
2jgz_A 289 Crystal Structure Of Phospho-Cdk2 In Complex With C 4e-04
4eoj_A 302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 4e-04
1w98_A 298 The Structural Basis Of Cdk2 Activation By Cyclin E 4e-04
1qmz_A 299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 4e-04
4eon_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-04
4eom_A 301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-04
3ezr_A 300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 4e-04
3bht_A 300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 4e-04
4eoo_A 299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 4e-04
1ogu_A 302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 4e-04
1e9h_A 297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 4e-04
4eop_A 300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 4e-04
4eoq_A 301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 4e-04
4bcq_A 301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 4e-04
1h1p_A 303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 4e-04
4eos_A 300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 4e-04
3qgw_A 286 Crystal Structure Of Itk Kinase Bound To An Inhibit 4e-04
2iw6_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 4e-04
1oit_A 299 Imidazopyridines: A Potent And Selective Class Of C 4e-04
1pf8_A 298 Crystal Structure Of Human Cyclin-dependent Kinase 4e-04
2w17_A 299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 4e-04
1vyw_A 309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 4e-04
1fin_A 298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 4e-04
4erw_A 306 Cdk2 In Complex With Staurosporine Length = 306 5e-04
4i3z_A 296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 5e-04
3pj8_A 299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 5e-04
3d94_A 301 Crystal Structure Of The Insulin-Like Growth Factor 5e-04
1jst_A 298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 5e-04
3lw0_A 304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 5e-04
3qhr_A 298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 5e-04
1gz8_A 299 Human Cyclin Dependent Kinase 2 Complexed With The 5e-04
3pxf_A 306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 5e-04
3gvu_A 292 The Crystal Structure Of Human Abl2 In Complex With 5e-04
2yjs_A 342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 5e-04
3lco_A 324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 5e-04
2ogv_A 317 Crystal Structure Of The Autoinhibited Human C-Fms 6e-04
3lcd_A 329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 6e-04
2i0v_A 335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 6e-04
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 6e-04
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-04
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-04
3bea_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 7e-04
2i1m_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 7e-04
3bz3_A 276 Crystal Structure Analysis Of Focal Adhesion Kinase 9e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 41/102 (40%), Positives = 63/102 (61%), Gaps = 1/102 (0%) Query: 121 EGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNV 180 E ++ + K F+ ++L+ A+DN+ I+G+GG G V+KG L DG +VAVK+ K Sbjct: 19 EVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQGG 78 Query: 181 E-QFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG 221 E QF EV ++S HRN+++L G C+ LLVY ++ NG Sbjct: 79 ELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANG 120
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 4e-34
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-33
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-31
3soc_A 322 Activin receptor type-2A; structural genomics cons 3e-19
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-17
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-17
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 2e-17
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-17
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-16
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 2e-16
4aoj_A 329 High affinity nerve growth factor receptor; transf 3e-16
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 3e-16
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 8e-16
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 2e-15
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 2e-15
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 3e-15
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 3e-15
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 6e-15
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 7e-15
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 9e-15
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 1e-14
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-14
3pls_A 298 Macrophage-stimulating protein receptor; protein k 2e-14
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 2e-14
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 2e-14
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-14
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 3e-14
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 7e-14
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 8e-14
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 8e-14
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 8e-14
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 1e-13
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-13
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-13
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 2e-13
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-13
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-13
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 4e-13
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 4e-13
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 4e-13
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 5e-13
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 5e-13
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 5e-13
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 5e-13
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 7e-13
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 8e-13
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 9e-13
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-12
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-12
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-12
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-12
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 3e-12
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 3e-12
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 4e-12
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-12
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 4e-12
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 5e-12
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-12
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 5e-12
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 6e-12
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 8e-12
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 1e-11
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-11
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 1e-11
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-11
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-11
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-11
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-11
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 2e-11
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 2e-11
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-11
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 3e-11
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-11
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 3e-11
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 4e-11
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 7e-11
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 7e-11
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 8e-11
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 9e-11
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 1e-10
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 1e-10
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-10
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-10
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-10
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 2e-10
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-10
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-09
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-10
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-10
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 3e-10
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-10
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-10
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-10
3niz_A 311 Rhodanese family protein; structural genomics, str 3e-10
2a19_B 284 Interferon-induced, double-stranded RNA-activated 4e-10
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 5e-10
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 5e-10
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 5e-10
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 6e-10
3q4u_A 301 Activin receptor type-1; structural genomics conso 1e-09
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 1e-09
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 1e-09
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 1e-09
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-09
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-08
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-05
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 1e-09
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 1e-09
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-09
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-09
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 2e-09
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-09
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 2e-09
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 2e-09
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 3e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 8e-08
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 3e-09
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 3e-09
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-09
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 3e-09
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 4e-09
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 4e-09
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 4e-09
3uqc_A 286 Probable conserved transmembrane protein; structur 5e-09
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 6e-09
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 6e-09
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 6e-09
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 7e-09
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 7e-09
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 7e-09
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 8e-09
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 8e-09
3o0g_A 292 Cell division protein kinase 5; kinase activator c 1e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-06
3bhy_A 283 Death-associated protein kinase 3; death associate 1e-08
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 1e-08
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-08
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 1e-08
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 1e-08
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 1e-08
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-08
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 5e-07
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 2e-08
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 2e-08
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-08
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 2e-08
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 2e-08
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 2e-08
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-08
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-08
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-08
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-08
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 3e-08
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 4e-08
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 4e-08
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 4e-08
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 5e-08
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 6e-08
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 7e-08
2bou_A143 EGF-like module containing mucin-like hormone rece 1e-07
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-07
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 1e-07
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-07
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-07
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 2e-07
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 2e-07
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 2e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 3e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-05
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-04
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-07
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 4e-07
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 5e-07
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 7e-07
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 8e-07
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-06
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 1e-06
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 2e-06
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 2e-06
3rp9_A 458 Mitogen-activated protein kinase; structural genom 3e-06
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 3e-06
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 3e-06
3ork_A 311 Serine/threonine protein kinase; structural genomi 4e-06
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 4e-06
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 4e-06
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 6e-06
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 7e-06
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 8e-06
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 9e-06
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 1e-05
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-05
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 1e-05
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 1e-05
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-05
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 2e-05
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 2e-05
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 2e-05
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 3e-05
3aln_A 327 Dual specificity mitogen-activated protein kinase; 3e-05
3an0_A 340 Dual specificity mitogen-activated protein kinase; 4e-05
2dyl_A 318 Dual specificity mitogen-activated protein kinase 5e-05
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 6e-05
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 7e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 7e-05
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 8e-05
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 8e-05
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 9e-05
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 9e-05
1nzi_A159 Complement C1S component; calcium, innate immunity 1e-04
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 1e-04
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-04
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-04
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-04
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 1e-04
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 1e-04
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 1e-04
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-04
3fme_A 290 Dual specificity mitogen-activated protein kinase; 1e-04
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 2e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-04
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-04
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 3e-04
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 3e-04
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 4e-04
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 4e-04
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 4e-04
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 4e-04
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 5e-04
2vh0_B134 Activated factor XA light chain; serine protease, 6e-04
2vh0_B134 Activated factor XA light chain; serine protease, 7e-04
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 6e-04
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 6e-04
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 7e-04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 7e-04
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 7e-04
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 8e-04
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 8e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 8e-04
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 8e-04
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 9e-04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
 Score =  123 bits (310), Expect = 4e-34
 Identities = 41/102 (40%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 121 EGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNV 180
           E ++ + K F+ ++L+ A+DN+    I+G+GG G V+KG L DG +VAVK+ K       
Sbjct: 11  EVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGG 70

Query: 181 E-QFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNG 221
           E QF  EV ++S   HRN+++L G C+     LLVY ++ NG
Sbjct: 71  ELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANG 112


>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.82
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.81
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.81
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.76
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.74
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.73
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.73
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.72
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.69
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.68
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.68
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.67
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.65
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.63
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.63
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.6
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.59
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.56
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.55
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.54
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.53
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.53
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.51
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.51
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.51
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.51
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.5
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.5
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.5
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.49
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.49
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.49
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.48
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.48
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.48
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.48
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.47
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.47
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.47
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.47
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.47
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.47
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.46
3uqc_A 286 Probable conserved transmembrane protein; structur 99.45
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.45
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.45
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.45
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.44
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.44
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.44
3niz_A 311 Rhodanese family protein; structural genomics, str 99.44
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.44
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.43
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.43
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.43
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.43
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.43
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.43
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.43
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.43
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.43
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.42
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.42
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.42
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.42
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.42
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.42
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.42
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.42
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.41
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.41
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.41
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.41
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.41
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.41
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.41
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.4
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.4
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.4
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.4
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.4
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.39
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.39
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.39
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.39
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.38
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.38
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.38
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.38
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.38
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.38
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.38
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.38
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.38
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.37
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.37
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.37
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.37
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.37
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.37
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.37
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.36
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.36
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.36
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.36
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.36
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.36
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.36
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.36
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.36
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.35
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.35
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.35
3bhy_A 283 Death-associated protein kinase 3; death associate 99.35
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.35
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.35
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.35
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.35
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.35
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.34
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.34
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.34
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.34
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.34
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.34
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.34
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.34
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.34
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.34
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.33
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.33
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.33
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.33
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.33
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.33
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.33
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.33
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.33
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.33
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.33
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.33
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.32
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.32
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.32
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.32
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.32
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.32
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.31
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.31
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.31
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.31
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.31
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.31
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.3
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.3
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.3
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.3
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.3
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.3
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.29
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.29
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.29
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.29
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.29
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.29
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.28
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.28
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.28
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.28
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.28
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.28
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.28
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.28
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.27
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.27
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.27
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.27
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.27
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.27
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.27
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.27
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.27
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.26
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.26
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.26
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.26
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.26
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.26
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.26
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.26
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.25
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.25
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.25
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.25
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.25
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.25
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.24
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.24
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.23
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.23
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.22
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.22
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.22
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.22
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.22
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.22
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.21
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.21
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.2
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.2
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.19
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.19
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.19
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.18
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.18
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.18
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.17
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.16
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.16
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.15
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.15
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.14
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.13
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.13
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.13
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.12
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.12
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.12
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.1
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.09
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.09
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.08
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.08
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.07
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.07
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.06
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.06
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.05
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.04
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.01
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 98.98
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 98.97
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 98.97
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 98.95
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 98.94
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.94
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 98.9
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 98.89
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 98.89
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 98.89
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 98.83
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.54
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.54
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 98.51
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.47
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.35
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.33
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.18
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 98.18
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.12
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.1
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.97
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.94
2bou_A143 EGF-like module containing mucin-like hormone rece 97.87
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 97.78
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.78
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.74
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.72
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.64
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.58
2bou_A143 EGF-like module containing mucin-like hormone rece 97.58
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.57
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.56
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.52
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.51
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.49
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.47
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 97.43
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.36
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.33
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.31
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.31
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.31
2vh0_B134 Activated factor XA light chain; serine protease, 97.26
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.14
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.13
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.1
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.07
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.0
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.99
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 96.96
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.91
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.9
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 96.79
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.79
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 96.76
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 96.74
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.69
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 96.69
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.69
1nzi_A159 Complement C1S component; calcium, innate immunity 96.68
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 96.65
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 96.62
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 96.51
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 96.41
1szb_A170 Mannose binding lectin-associated serine protease- 96.4
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.39
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 96.34
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.32
2wph_E59 Coagulation factor IXA light chain; serine proteas 96.31
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 96.2
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 95.82
1aut_L114 Activated protein C; serine proteinase, plasma cal 95.76
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 95.7
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 95.65
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 95.63
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 95.58
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 95.58
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 95.58
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.41
3v65_B 386 Low-density lipoprotein receptor-related protein; 95.36
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 95.34
2vh0_B134 Activated factor XA light chain; serine protease, 95.3
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 95.11
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 94.95
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 94.83
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 94.41
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 94.01
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 93.92
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 93.79
4gkh_A 272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 93.42
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 93.37
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.31
2knc_B79 Integrin beta-3; transmembrane signaling, protein 93.04
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 93.01
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 93.01
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 91.63
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 91.51
3ats_A 357 Putative uncharacterized protein; hypothetical pro 91.26
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 91.24
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 90.82
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 90.77
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 90.67
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 90.6
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 90.15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 89.32
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 89.13
1ob1_C99 Major merozoite surface protein; immune system, im 88.16
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 88.05
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 87.83
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 87.54
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 86.61
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 85.27
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 83.89
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 83.08
3sg8_A 304 APH(2'')-ID; antibiotic resistance enzyme, transfe 82.65
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 81.75
2q83_A 346 YTAA protein; 2635576, structural genomics, joint 81.26
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
Probab=99.82  E-value=2.9e-20  Score=143.05  Aligned_cols=85  Identities=29%  Similarity=0.553  Sum_probs=74.2

Q ss_pred             hhccCccccceecccCceEEEEEEeC------CCcEEEEEeccCCCcccHHHHHHHHHHHHcCCCCceeeeeeEEEeCCe
Q 036177          137 KATDNYKVSRIIGQGGQGTVFKGMLT------DGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEV  210 (221)
Q Consensus       137 ~~~~~~~~~~~lg~G~fg~v~~~~~~------~~~~vavk~~~~~~~~~~~~~~~e~~~l~~l~h~niv~l~g~~~~~~~  210 (221)
                      +.+++|.+.+.||+|+||.||+|.+.      ++..||||.++..+....++|.+|+.+|++++|||||+++|++...++
T Consensus        10 I~r~~~~l~~~lG~G~fG~Vy~a~~~~~~~~~~~~~vAvK~l~~~~~~~~~~f~~E~~il~~l~HpnIV~l~g~~~~~~~   89 (299)
T 4asz_A           10 IKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDP   89 (299)
T ss_dssp             CCGGGEEEEEEEEC--CCCEEEEEECSCC----CEEEEEEEECSCCHHHHHHHHHHHHHHTTCCCTTBCCEEEEECSSSS
T ss_pred             cCHHHeEEeeEEeeCCCcEEEEEEECCcccCCCCEEEEEEEeCCCChHHHHHHHHHHHHHHhCCCCCCccEEEEEeeCCE
Confidence            45677888999999999999999863      367899999987777777889999999999999999999999999999


Q ss_pred             eEEEEEcccCC
Q 036177          211 PLLVYEFILNG  221 (221)
Q Consensus       211 ~~lv~e~~~~G  221 (221)
                      .+||||||++|
T Consensus        90 ~~lV~Ey~~~G  100 (299)
T 4asz_A           90 LIMVFEYMKHG  100 (299)
T ss_dssp             EEEEEECCTTC
T ss_pred             EEEEEEcCCCC
Confidence            99999999987



>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2knc_B Integrin beta-3; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 221
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-22
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 6e-22
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-21
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-21
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-21
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-21
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-21
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-21
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-21
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-20
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-20
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-20
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-20
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-19
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-19
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 4e-19
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-18
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-18
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-18
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-18
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-18
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-18
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-18
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 3e-18
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 3e-18
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-18
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-18
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 6e-18
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 6e-18
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-17
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-17
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 4e-17
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 7e-17
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 7e-17
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 8e-17
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 8e-17
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-16
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-16
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-16
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-16
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-16
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 8e-16
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-15
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-15
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-15
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 5e-15
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 7e-15
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-14
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-14
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-14
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-14
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-14
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-14
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 8e-14
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 8e-14
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-13
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-13
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-13
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-12
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 4e-12
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 5e-12
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 8e-12
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 9e-11
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 4e-10
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 5e-09
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 7e-09
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 1e-08
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 1e-08
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-08
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 7e-08
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 5e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 7e-07
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 7e-07
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 1e-06
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 1e-06
d1gl4a240 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 1e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-05
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 2e-05
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 8e-05
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 2e-04
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 0.001
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 0.001
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 0.002
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.002
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 0.002
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Dual specificity mitogen-activated protein kinase kinase 1, Mek1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 91.3 bits (226), Expect = 1e-22
 Identities = 20/89 (22%), Positives = 35/89 (39%), Gaps = 2/89 (2%)

Query: 135 LEKATDNYKVSRIIGQGGQGTVFKGM-LTDGRIVAVKK-SKSVHESNVEQFINEVVILSQ 192
           +E   D+++    +G G  G VFK      G ++A K     +  +   Q I E+ +L +
Sbjct: 1   MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE 60

Query: 193 INHRNVVKLLGCCLETEVPLLVYEFILNG 221
            N   +V   G         +  E +  G
Sbjct: 61  CNSPYIVGFYGAFYSDGEISICMEHMDGG 89


>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.78
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.76
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.75
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.75
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.74
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.73
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.73
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.73
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.72
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.7
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.69
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.69
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.69
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.69
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.69
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.68
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.68
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.68
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.68
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.68
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.67
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.67
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.67
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.67
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.65
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.65
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.64
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.64
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.64
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.63
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.63
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.61
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.61
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.6
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.6
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.6
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.59
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.58
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.58
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.57
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.56
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.55
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.54
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.53
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.51
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.5
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.48
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.46
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.45
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.44
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.44
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.43
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.41
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.39
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.36
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.36
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.35
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.23
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.23
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.84
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.84
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.54
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.48
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.4
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.39
d1szba245 Mannose-binding protein associated serine protease 98.32
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.3
d1nt0a345 Mannose-binding protein associated serine protease 98.27
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.01
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.74
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.74
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.49
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.39
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.14
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.12
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.07
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.05
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.03
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 96.98
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.84
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.52
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.42
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.94
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 95.51
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 95.47
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.45
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 95.18
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 95.03
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 94.81
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 94.27
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 93.87
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 93.63
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 93.36
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 90.69
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 89.37
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 86.31
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 86.31
d1ccva_56 Chymotrypsin inhibitor AMCI {Honeybee (Apis mellif 83.27
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 82.47
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.78  E-value=4e-19  Score=133.41  Aligned_cols=88  Identities=25%  Similarity=0.425  Sum_probs=77.6

Q ss_pred             hhhhhhhccCccccceecccCceEEEEEEeCCCcEEEEEeccCCCcccHHHHHHHHHHHHcCCCCceeeeeeEEEeCCee
Q 036177          132 SKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIVAVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVP  211 (221)
Q Consensus       132 ~~~~~~~~~~~~~~~~lg~G~fg~v~~~~~~~~~~vavk~~~~~~~~~~~~~~~e~~~l~~l~h~niv~l~g~~~~~~~~  211 (221)
                      .++|+++.++|.+.+.||+|+||.||+|.++++..||||.++... ...+.|.+|+.+|++++|||||+++|++. .+..
T Consensus         5 ~~~wei~~~~~~~~~~iG~G~fg~Vy~~~~~~~~~vAvK~~~~~~-~~~~~~~~E~~~l~~l~HpnIv~~~g~~~-~~~~   82 (272)
T d1qpca_           5 EDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGS-MSPDAFLAEANLMKQLQHQRLVRLYAVVT-QEPI   82 (272)
T ss_dssp             TCTTBCCGGGEEEEEEEEEETTEEEEEEEETTTEEEEEEEECTTS-SCHHHHHHHHHHHHHCCCTTBCCEEEEEC-SSSC
T ss_pred             CCCeecCHHHeEEeEEEecCCCcEEEEEEECCCCEEEEEEEccCc-CCHHHHHHHHHHHHhCCCCCEeEEEeeec-cCCe
Confidence            467889999999999999999999999999888899999987533 34578999999999999999999999875 4567


Q ss_pred             EEEEEcccCC
Q 036177          212 LLVYEFILNG  221 (221)
Q Consensus       212 ~lv~e~~~~G  221 (221)
                      ++||||+++|
T Consensus        83 ~iv~Ey~~~g   92 (272)
T d1qpca_          83 YIITEYMENG   92 (272)
T ss_dssp             EEEEECCTTC
T ss_pred             EEEEEeCCCC
Confidence            9999999987



>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccva_ g.22.1.1 (A:) Chymotrypsin inhibitor AMCI {Honeybee (Apis mellifera) [TaxId: 7460]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure