Citrus Sinensis ID: 036202

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MTVALPSPRSRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD
cccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHcccc
cHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHHcccHHHHccccccHHHHHHHHHHccccc
mtvalpsprsrkigsllreGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIkgagtdedaLTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD
mtvalpsprsrkigsllreGDQVNEFAAALRTAIRCINNSNKYYEKIIRnaikgagtdedaLTRVIVTraekdlkvikevyykrnsvtleqavakdtsgdYNAFLLTLLGKAD
MTVALPSPRSRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD
*********************QVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLL****
MTVALPSPRSRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGK**
*********SRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD
MTVALPSPRSRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVALPSPRSRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
P51074314 Annexin-like protein RJ4 N/A no 0.858 0.308 0.747 5e-36
Q94CK4316 Annexin D8 OS=Arabidopsis yes no 0.787 0.281 0.651 2e-28
Q9SYT0317 Annexin D1 OS=Arabidopsis no no 0.849 0.302 0.515 1e-22
Q9LX08318 Annexin D6 OS=Arabidopsis no no 0.858 0.305 0.540 2e-22
Q9LX07316 Annexin D7 OS=Arabidopsis no no 0.796 0.284 0.533 2e-21
Q9XEE2317 Annexin D2 OS=Arabidopsis no no 0.858 0.305 0.474 3e-20
Q9SE45321 Annexin D3 OS=Arabidopsis no no 0.716 0.252 0.469 4e-17
Q9C9X3316 Annexin D5 OS=Arabidopsis no no 0.876 0.313 0.43 2e-15
P20073488 Annexin A7 OS=Homo sapien yes no 0.734 0.170 0.392 3e-12
Q07076463 Annexin A7 OS=Mus musculu yes no 0.734 0.179 0.380 4e-12
>sp|P51074|ANX4_FRAAN Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/99 (74%), Positives = 84/99 (84%), Gaps = 2/99 (2%)

Query: 15  SLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDL 74
           +LL EG   N+F  AL TAIRC+N+  KY+EK++RNAIK  GTDEDALTRVIVTRAE+DL
Sbjct: 218 NLLEEG--ANDFQKALHTAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRAERDL 275

Query: 75  KVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD 113
           + IKEVYYK+NSV LEQAVAKDTSGDY AFLLTLLGK D
Sbjct: 276 RDIKEVYYKKNSVPLEQAVAKDTSGDYKAFLLTLLGKED 314

Fragaria ananassa (taxid: 3747)
>sp|Q94CK4|ANXD8_ARATH Annexin D8 OS=Arabidopsis thaliana GN=ANNAT8 PE=2 SV=2 Back     alignment and function description
>sp|Q9SYT0|ANXD1_ARATH Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LX08|ANXD6_ARATH Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LX07|ANXD7_ARATH Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1 Back     alignment and function description
>sp|Q9XEE2|ANXD2_ARATH Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SE45|ANXD3_ARATH Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9X3|ANXD5_ARATH Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2 Back     alignment and function description
>sp|P20073|ANXA7_HUMAN Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3 Back     alignment and function description
>sp|Q07076|ANXA7_MOUSE Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
643076 271 annexin, partial [Fragaria x ananassa] 0.858 0.357 0.747 2e-34
21264397 314 RecName: Full=Annexin-like protein RJ4 g 0.858 0.308 0.747 2e-34
224075824 301 predicted protein [Populus trichocarpa] 0.778 0.292 0.784 2e-32
211906452 314 annexin [Gossypium hirsutum] 0.840 0.302 0.705 2e-32
315229327 315 annexin-like protein [Arachis hypogaea v 0.796 0.285 0.744 6e-32
356548895 314 PREDICTED: annexin-like protein RJ4-like 0.787 0.283 0.741 1e-31
356548893 314 PREDICTED: annexin-like protein RJ4-like 0.787 0.283 0.741 1e-31
363806816 313 uncharacterized protein LOC100784424 [Gl 0.831 0.300 0.712 2e-31
359806539 313 uncharacterized protein LOC100796092 [Gl 0.849 0.306 0.704 2e-30
359806499 314 uncharacterized protein LOC100794511 [Gl 0.787 0.283 0.719 4e-30
>gi|643076|gb|AAA79922.1| annexin, partial [Fragaria x ananassa] Back     alignment and taxonomy information
 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/99 (74%), Positives = 84/99 (84%), Gaps = 2/99 (2%)

Query: 15  SLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDL 74
           +LL EG   N+F  AL TAIRC+N+  KY+EK++RNAIK  GTDEDALTRVIVTRAE+DL
Sbjct: 175 NLLEEG--ANDFQKALHTAIRCLNDPKKYFEKVLRNAIKRVGTDEDALTRVIVTRAERDL 232

Query: 75  KVIKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD 113
           + IKEVYYK+NSV LEQAVAKDTSGDY AFLLTLLGK D
Sbjct: 233 RDIKEVYYKKNSVPLEQAVAKDTSGDYKAFLLTLLGKED 271

Source: Fragaria x ananassa

Species: Fragaria x ananassa

Genus: Fragaria

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|21264397|sp|P51074.2|ANX4_FRAAN RecName: Full=Annexin-like protein RJ4 gi|6010777|gb|AAF01250.1| annexin [Fragaria x ananassa] Back     alignment and taxonomy information
>gi|224075824|ref|XP_002304784.1| predicted protein [Populus trichocarpa] gi|222842216|gb|EEE79763.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|211906452|gb|ACJ11719.1| annexin [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|315229327|gb|ADT91309.1| annexin-like protein [Arachis hypogaea var. vulgaris] Back     alignment and taxonomy information
>gi|356548895|ref|XP_003542834.1| PREDICTED: annexin-like protein RJ4-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356548893|ref|XP_003542833.1| PREDICTED: annexin-like protein RJ4-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|363806816|ref|NP_001242031.1| uncharacterized protein LOC100784424 [Glycine max] gi|255642132|gb|ACU21331.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359806539|ref|NP_001241261.1| uncharacterized protein LOC100796092 [Glycine max] gi|255645094|gb|ACU23046.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359806499|ref|NP_001240999.1| uncharacterized protein LOC100794511 [Glycine max] gi|255634710|gb|ACU17717.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
TAIR|locus:505006606316 ANNAT8 "annexin 8" [Arabidopsi 0.769 0.275 0.666 5.7e-27
TAIR|locus:2184108318 ANN6 "annexin 6" [Arabidopsis 0.858 0.305 0.540 2.1e-22
TAIR|locus:2011344317 ANNAT1 "annexin 1" [Arabidopsi 0.858 0.305 0.515 2.6e-22
TAIR|locus:2184123316 ANNAT7 "annexin 7" [Arabidopsi 0.823 0.294 0.531 3.9e-21
TAIR|locus:2177709317 ANNAT2 "annexin 2" [Arabidopsi 0.893 0.318 0.465 4.4e-20
TAIR|locus:2064217321 ANNAT3 "annexin 3" [Arabidopsi 0.761 0.267 0.441 5.8e-17
TAIR|locus:2200281316 ANN5 "annexin 5" [Arabidopsis 0.876 0.313 0.43 4.8e-16
ZFIN|ZDB-GENE-010406-1316 anxa13 "annexin A13" [Danio re 0.690 0.246 0.423 6e-14
ZFIN|ZDB-GENE-050522-310316 zgc:112421 "zgc:112421" [Danio 0.690 0.246 0.410 2.9e-13
UNIPROTKB|F1NNR3319 ANXA13 "Annexin" [Gallus gallu 0.716 0.253 0.419 1.1e-12
TAIR|locus:505006606 ANNAT8 "annexin 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 303 (111.7 bits), Expect = 5.7e-27, P = 5.7e-27
 Identities = 58/87 (66%), Positives = 71/87 (81%)

Query:    24 NEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYK 83
             NE+ +ALR AIRCI N  +YY K++RN+I   GTDEDAL RVIVTRAEKDL  I  +Y+K
Sbjct:   225 NEYLSALRAAIRCIKNPTRYYAKVLRNSINTVGTDEDALNRVIVTRAEKDLTNITGLYFK 284

Query:    84 RNSVTLEQAVAKDTSGDYNAFLLTLLG 110
             RN+V+L+QA+AK+TSGDY AFLL LLG
Sbjct:   285 RNNVSLDQAIAKETSGDYKAFLLALLG 311
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005544 "calcium-dependent phospholipid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0009408 "response to heat" evidence=IEP
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
TAIR|locus:2184108 ANN6 "annexin 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011344 ANNAT1 "annexin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184123 ANNAT7 "annexin 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177709 ANNAT2 "annexin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064217 ANNAT3 "annexin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200281 ANN5 "annexin 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010406-1 anxa13 "annexin A13" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-310 zgc:112421 "zgc:112421" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNR3 ANXA13 "Annexin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00031646
hypothetical protein (301 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
pfam0019166 pfam00191, Annexin, Annexin 8e-20
smart0033553 smart00335, ANX, Annexin repeats 1e-16
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information 
 Score = 75.9 bits (188), Expect = 8e-20
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 43  YYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNSVTLEQAVAKDTSGDYN 102
           Y  +++R A+KG GTDED L R++ TR+   L+ I+E Y K     LE+ +  +TSGD+ 
Sbjct: 1   YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKLYGKDLEKDIKSETSGDFE 60

Query: 103 AFLLTL 108
             LL L
Sbjct: 61  KLLLAL 66

This family of annexins also includes giardin that has been shown to function as an annexin. Length = 66
>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
KOG0819321 consensus Annexin [Intracellular trafficking, secr 99.98
KOG0819 321 consensus Annexin [Intracellular trafficking, secr 99.97
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 99.88
smart0033553 ANX Annexin repeats. 99.72
smart0033553 ANX Annexin repeats. 96.62
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 96.62
>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=99.98  E-value=2.9e-33  Score=213.82  Aligned_cols=106  Identities=37%  Similarity=0.574  Sum_probs=104.1

Q ss_pred             CCCCCcHHHHHhhcCCCCchHHHHHHHHHHHhcCchHHHHHHHHHHhhcCCCcHHHHHHHHHhcCHHHHHHHHHHHHhhc
Q 036202            6 PSPRSRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRN   85 (113)
Q Consensus         6 ~~~~~~L~~~lk~e~~~sG~~~~~l~~lv~~~~~~~~~dA~~L~~A~kg~gtde~~Li~Il~~rs~~~l~~Ik~~Y~~~y   85 (113)
                      +..|+++.++|++|+  ||+|+.+|++++.|+++||.|||+.||.||+|.|||+++||||+||||+.||..|+..|+++|
T Consensus       216 ~~~g~diek~I~~e~--~gd~~~~llaiv~c~~n~~~yFA~~L~~amkg~GTdd~~LiRI~VsRsEiDl~~Ik~ef~~~Y  293 (321)
T KOG0819|consen  216 RISGKDIEKSIKEEF--SGDFEKLLLAIVKCIRNPPAYFAERLRKAMKGLGTDDKTLIRIVVSRSEIDLLDIKEEFQRKY  293 (321)
T ss_pred             HhcchhHHHHHhhcc--CchHHHHHHHHHHHHcCHHHHHHHHHHHHHhccCCCccceeeeeeeHHHhhHHHHHHHHHHHh
Confidence            467999999999999  999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcHHHHHhhcccHHHHHHHHHhhccCC
Q 036202           86 SVTLEQAVAKDTSGDYNAFLLTLLGKAD  113 (113)
Q Consensus        86 gksL~~~I~~~~sG~~~~~Ll~l~~~~~  113 (113)
                      |+||.++|+++|||||+++|++||+++|
T Consensus       294 ~ksL~~~I~~dtsGdY~~~LlaL~g~~~  321 (321)
T KOG0819|consen  294 GKSLYSAIKGDTSGDYKKALLALLGGDD  321 (321)
T ss_pred             CccHHHHHhhhccchHHHHHHHHhCCCC
Confidence            9999999999999999999999999987

>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
1ycn_A317 X-Ray Structure Of Annexin From Arabidopsis Thalian 9e-24
1n00_A321 Annexin Gh1 From Cotton Length = 321 4e-22
3brx_A317 Crystal Structure Of Calcium-Bound Cotton Annexin G 4e-22
1dk5_A322 Crystal Structure Of Annexin 24(Ca32) From Capsicum 2e-20
1ala_A321 Structure Of Chicken Annexin V At 2.25-Angstroms Re 7e-13
1yii_A320 Crystal Structures Of Chicken Annexin V In Complex 7e-13
1w45_A327 The 2.5 Angstroem Structure Of The K16a Mutant Of A 5e-12
1w3w_A327 The 2.1 Angstroem Resolution Structure Of Annexin A 5e-12
1aow_A309 Annexin Iv Length = 309 2e-11
1i4a_A318 Crystal Structure Of Phosphorylation-Mimicking Muta 2e-11
1ann_A318 Annexin Iv Length = 318 2e-11
1aii_A323 Annexin Iii Length = 323 4e-11
2zoc_A319 Crystal Structure Of Recombinant Human Annexin Iv L 4e-11
1axn_A323 The High Resolution Structure Of Annexin Iii Shows 5e-11
1avc_A 673 Bovine Annexin Vi (Calcium-Bound) Length = 673 1e-10
2zhi_A322 Crystal Structure Analysis Of The Sodium-Bound Anne 2e-10
1m9i_A 672 Crystal Structure Of Phosphorylation-Mimicking Muta 2e-10
1ain_A314 Crystal Structure Of Human Annexin I At 2.5 Angstro 3e-10
1aei_A315 Crystal Structure Of The Annexin Xii Hexamer Length 5e-10
1dm5_A315 Annexin Xii E105k Homohexamer Crystal Structure Len 5e-10
1hm6_A346 X-Ray Structure Of Full-Length Annexin 1 Length = 3 1e-09
1bcz_A319 Recombinant Rat Annexin V, T72s Mutant Length = 319 1e-09
1n44_A319 Crystal Structure Of Annexin V R23e Mutant Length = 1e-09
1bcw_A319 Recombinant Rat Annexin V, T72a Mutant Length = 319 1e-09
1n42_A319 Crystal Structure Of Annexin V R149e Mutant Length 1e-09
1g5n_A318 Annexin V Complex With Heparin Oligosaccharides Len 1e-09
1a8a_A319 Rat Annexin V Complexed With Glycerophosphoserine L 1e-09
1n41_A319 Crystal Structure Of Annexin V K27e Mutant Length = 1e-09
1bcy_A319 Recombinant Rat Annexin V, T72k Mutant Length = 319 1e-09
1bc0_A319 Recombinant Rat Annexin V, W185a Mutant Length = 31 1e-09
1bc3_A319 Recombinant Rat Annexin V, Triple Mutant (T72k, S14 1e-09
1hvd_A319 Structural And Electrophysiological Analysis Of Ann 2e-09
1hvf_A319 Structural And Electrophysiological Analysis Of Ann 2e-09
1hve_A319 Structural And Electrophysiological Analysis Of Ann 2e-09
1anw_A319 The Effect Of Metal Binding On The Structure Of Ann 2e-09
1avh_A320 Crystal And Molecular Structure Of Human Annexin V 2e-09
1sav_A320 Human Annexin V With Proline Substitution By Thiopr 2e-09
2h0m_A318 Structure Of A Mutant Of Rat Annexin A5 Length = 31 2e-09
2h0l_A318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 2e-09
2h0k_A318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 2e-09
2ran_A316 Rat Annexin V Crystal Structure: Ca2+-Induced Confo 3e-09
1bc1_A319 Recombinant Rat Annexin V, Quadruple Mutant (T72k, 5e-09
2xo2_A 320 Human Annexin V With Incorporated Methionine Analog 7e-09
1w7b_A339 Annexin A2: Does It Induce Membrane Aggregation By 1e-08
2hyu_A308 Human Annexin A2 With Heparin Tetrasaccharide Bound 2e-08
1xjl_A319 Structure Of Human Annexin A2 In The Presence Of Ca 2e-08
3chj_A 337 Crystal Structure Of Alpha-14 Giardin Length = 337 7e-05
>pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (261), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 67/97 (69%)
Query: 17  LREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKV 76
           L EGD  ++F A LR+ I+C+     Y+  ++R+AI   GTDE ALTR++ TRAE DLKV
Sbjct: 220 LEEGDDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKV 279
Query: 77  IKEVYYKRNSVTLEQAVAKDTSGDYNAFLLTLLGKAD 113
           I E Y +RNS+ LE+A+ KDT GDY   L+ LLG+ D
Sbjct: 280 IGEEYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDD 316
>pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 Back     alignment and structure
>pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 Back     alignment and structure
>pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum Annuum Length = 322 Back     alignment and structure
>pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 Back     alignment and structure
>pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 Back     alignment and structure
>pdb|1W45|A Chain A, The 2.5 Angstroem Structure Of The K16a Mutant Of Annexin A8, Which Has An Intact N-Terminus. Length = 327 Back     alignment and structure
>pdb|1W3W|A Chain A, The 2.1 Angstroem Resolution Structure Of Annexin A8 Length = 327 Back     alignment and structure
>pdb|1AOW|A Chain A, Annexin Iv Length = 309 Back     alignment and structure
>pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 Back     alignment and structure
>pdb|1ANN|A Chain A, Annexin Iv Length = 318 Back     alignment and structure
>pdb|1AII|A Chain A, Annexin Iii Length = 323 Back     alignment and structure
>pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 Back     alignment and structure
>pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 Back     alignment and structure
>pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 Back     alignment and structure
>pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 Back     alignment and structure
>pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 Back     alignment and structure
>pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 Back     alignment and structure
>pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 Back     alignment and structure
>pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 Back     alignment and structure
>pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 Back     alignment and structure
>pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 Back     alignment and structure
>pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 Back     alignment and structure
>pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 Back     alignment and structure
>pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 Back     alignment and structure
>pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 Back     alignment and structure
>pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 Back     alignment and structure
>pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 Back     alignment and structure
>pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 Back     alignment and structure
>pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 Back     alignment and structure
>pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 Back     alignment and structure
>pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 Back     alignment and structure
>pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 Back     alignment and structure
>pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 Back     alignment and structure
>pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 Back     alignment and structure
>pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 Back     alignment and structure
>pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 Back     alignment and structure
>pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 Back     alignment and structure
>pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 Back     alignment and structure
>pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 Back     alignment and structure
>pdb|3CHJ|A Chain A, Crystal Structure Of Alpha-14 Giardin Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 2e-28
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 8e-13
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 3e-08
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 5e-06
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 3e-27
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 2e-08
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 1e-07
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 7e-27
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 3e-14
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 2e-08
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 6e-06
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 2e-26
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 2e-13
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 1e-08
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 2e-05
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 2e-26
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 1e-14
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 8e-08
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 2e-26
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 4e-23
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 2e-14
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 4e-14
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 6e-09
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 3e-07
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 9e-06
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 7e-05
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 5e-26
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 3e-13
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 9e-09
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 3e-04
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 5e-26
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 4e-15
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 8e-09
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 8e-05
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 6e-26
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 2e-14
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 8e-09
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 2e-05
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 2e-25
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 9e-15
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 7e-09
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 8e-06
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 5e-25
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 1e-12
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 7e-05
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 4e-17
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 1e-11
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 8e-08
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 6e-05
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
 Score =  103 bits (259), Expect = 2e-28
 Identities = 48/89 (53%), Positives = 61/89 (68%)

Query: 24  NEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYK 83
           +EF A LR+ ++C+    KY+EK++R AI   GTDE ALTRV+ TRAE DLKVI + Y +
Sbjct: 231 DEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGALTRVVCTRAEVDLKVIADEYQR 290

Query: 84  RNSVTLEQAVAKDTSGDYNAFLLTLLGKA 112
           RNSV L +A+ KDT GDY   LL L G  
Sbjct: 291 RNSVPLTRAIVKDTHGDYEKLLLVLAGHV 319
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 99.97
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 99.97
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 99.97
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 99.97
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 99.97
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 99.97
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 99.96
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 99.96
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 99.96
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 99.96
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 99.96
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 99.96
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 99.95
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 99.95
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 99.95
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 99.95
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 99.95
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 99.95
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 99.95
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 99.95
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 99.93
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.93
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 99.91
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.91
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
Probab=99.97  E-value=1.8e-31  Score=205.46  Aligned_cols=104  Identities=35%  Similarity=0.520  Sum_probs=101.8

Q ss_pred             CCCCcHHHHHhhcCCCCchHHHHHHHHHHHhcCchHHHHHHHHHHhhcCCCcHHHHHHHHHhcCHHHHHHHHHHHHhhcC
Q 036202            7 SPRSRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNS   86 (113)
Q Consensus         7 ~~~~~L~~~lk~e~~~sG~~~~~l~~lv~~~~~~~~~dA~~L~~A~kg~gtde~~Li~Il~~rs~~~l~~Ik~~Y~~~yg   86 (113)
                      .+|++|.++|++|+  ||||+++|++++.|..+|+.|||+.|++||+|.|||+.+||+|+|+|++.||..|+++|++.||
T Consensus       223 ~~g~~L~~~I~~e~--sGd~~~~Llalv~~~~~~~~~fA~~L~~amkg~GTdd~~LiriivsR~e~dl~~Ik~~y~~~yg  300 (327)
T 1w3w_A          223 IANKSIEDSIKSET--HGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYG  300 (327)
T ss_dssp             HHSSCHHHHHHHHC--CHHHHHHHHHHHHHHHCHHHHHHHHHHHHHSSSSCCHHHHHHHHHHHTTTTHHHHHHHHHHHHS
T ss_pred             HHCCCHHHHHhhhc--CCcHHHHHHHHHHHcCCHHHHHHHHHHhhccCCCCChhHeeeeeeECCHHHHHHHHHHHHHHhC
Confidence            46899999999999  9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcHHHHHhhcccHHHHHHHHHhhccC
Q 036202           87 VTLEQAVAKDTSGDYNAFLLTLLGKA  112 (113)
Q Consensus        87 ksL~~~I~~~~sG~~~~~Ll~l~~~~  112 (113)
                      ++|+++|+++|||||+++|++||+++
T Consensus       301 ~sL~~~I~~~tsGdy~~~LlaL~~~~  326 (327)
T 1w3w_A          301 KTLSSMIMEDTSGDYKNALLSLVGSD  326 (327)
T ss_dssp             SCHHHHHHHHCCHHHHHHHHHHHCCC
T ss_pred             CcHHHHHhhhCChHHHHHHHHHhCCC
Confidence            99999999999999999999999875
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 8e-32
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 2e-11
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 5e-09
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 1e-30
d1hm6a_ 343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 4e-11
d1hm6a_ 343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 1e-08
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 3e-30
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 7e-12
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 7e-09
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 0.001
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 7e-30
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 4e-10
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 1e-08
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 0.003
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 1e-29
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 1e-09
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 2e-09
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 4e-04
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 5e-29
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 7e-11
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 9e-09
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 5e-29
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 6e-12
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 3e-09
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 6e-29
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 4e-11
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 8e-10
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 9e-06
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 2e-28
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 2e-11
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 3e-09
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 9e-06
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 7e-18
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure

class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin GH1
species: Cotton (Gossypium hirsutum) [TaxId: 3635]

 Score =  111 bits (279), Expect = 8e-32
 Identities = 48/90 (53%), Positives = 62/90 (68%)

Query: 24  NEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYK 83
           +EF A LR+ ++C+    KY+EK++R AI   GTDE ALTRV+ TRAE DLKVI + Y +
Sbjct: 228 DEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGALTRVVCTRAEVDLKVIADEYQR 287

Query: 84  RNSVTLEQAVAKDTSGDYNAFLLTLLGKAD 113
           RNSV L +A+ KDT GDY   LL L G  +
Sbjct: 288 RNSVPLTRAIVKDTHGDYEKLLLVLAGHVE 317
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1axna_323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1avca1341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1i4aa_309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1w7ba_319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1avca2321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.97
d2ie7a1318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 99.97
d1dm5a_315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 99.96
d1hm6a_343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 99.96
d1n00a_318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.96
d1avca2 321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1n00a_ 318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.95
d1w7ba_ 319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1avca1 341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1hm6a_ 343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 99.94
d1axna_ 323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1i4aa_ 309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.94
d2ie7a1 318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 99.94
d1dm5a_ 315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 99.94
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 96.63
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin III
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=1.5e-31  Score=203.73  Aligned_cols=105  Identities=32%  Similarity=0.511  Sum_probs=103.2

Q ss_pred             CCCCcHHHHHhhcCCCCchHHHHHHHHHHHhcCchHHHHHHHHHHhhcCCCcHHHHHHHHHhcCHHHHHHHHHHHHhhcC
Q 036202            7 SPRSRKIGSLLREGDQVNEFAAALRTAIRCINNSNKYYEKIIRNAIKGAGTDEDALTRVIVTRAEKDLKVIKEVYYKRNS   86 (113)
Q Consensus         7 ~~~~~L~~~lk~e~~~sG~~~~~l~~lv~~~~~~~~~dA~~L~~A~kg~gtde~~Li~Il~~rs~~~l~~Ik~~Y~~~yg   86 (113)
                      .+|++|.++|++|+  ||+|+.++++++.|..+|+.|+|+.|+.||+|.|||+.+||||+++|++.||..|+++|++.||
T Consensus       219 ~~~~~l~~~i~~e~--sG~~~~al~~~~~~~~~p~~~~A~~L~~Am~G~gtd~~~LiRiivtr~e~dl~~Ik~~y~~~yg  296 (323)
T d1axna_         219 ISQKDIVDSIKGEL--SGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYG  296 (323)
T ss_dssp             HHSSCHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSSCCHHHHHHHHHHHTTTTHHHHHHHHHHHHS
T ss_pred             hhcchHHHHHHHhc--CchHHHHHHHHHHHhccHHHHHHHHHHHHhcccCCChhhheeeeeecCHHHHHHHHHHHHHHHC
Confidence            36899999999999  9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcHHHHHhhcccHHHHHHHHHhhccCC
Q 036202           87 VTLEQAVAKDTSGDYNAFLLTLLGKAD  113 (113)
Q Consensus        87 ksL~~~I~~~~sG~~~~~Ll~l~~~~~  113 (113)
                      ++|+++|+++|||+|+++|++||+++|
T Consensus       297 ~sL~~~I~~etsGdy~~~Ll~Ll~~~~  323 (323)
T d1axna_         297 YSLYSAIKSDTSGDYEITLLKICGGDD  323 (323)
T ss_dssp             SCHHHHHHHHCCHHHHHHHHHHHCSCC
T ss_pred             CCHHHHHhhhCChHHHHHHHHHhCCCC
Confidence            999999999999999999999999998
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure