Citrus Sinensis ID: 036208

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT
ccccccccEEEEEccccccEEEEEEccEEEEEcccccccccccEEEEcccccccHHHHHHcccccccccccccccccccccccHHHHcccccccEEEEEccccccEEEEEEccEEccccHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccccccEEEEEEEcccccEEEEEEEEEccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccc
cccccccccEEEEccccEEEEEEEEccEEEEcccccccccEEccEEEccccEEEcHHHHccccccHHHEEccHHHccccccccHHHHHHHHHcccEEEEEEccEEEEEEEEccEEEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccccccEEEEEEEEEccccEEEEEEEEEccEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHH
magkgegpaigidlgttyscvgvwQHDRVEIIandqgnrttpsyvaftdtERLIGdaaknqvamnptntvfdakrligrrfsdpsvqsdmklwpfkviagagdkpmivvnykgeekqfSAEEISSMVLNKMKEIAEAYLGTTIKNAVvtvpayfndsqrqatkdagviSGLNVMRIINEPTAAAIAYGldkkagstgekNVLIFDlgggtfdvsLLTIEEGIFEVkatagdthlggedfdnRMVNHFVQEFKRknkkdisgnpRALRRLRTACERAKRT
magkgegpaigidlGTTYSCVGVWQHDRVEiiandqgnrttpsyvAFTDTERLIGDaaknqvamnptntvfdakrlIGRRfsdpsvqsdmklWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQefkrknkkdisgnpralrrlrtacerakrt
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT
********AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQE*****************************
*****EG**IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNK****GNPRALRRLRTACERAKR*
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT
******GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
P09189 651 Heat shock cognate 70 kDa N/A no 1.0 0.428 0.960 1e-158
P27322 644 Heat shock cognate 70 kDa N/A no 1.0 0.433 0.953 1e-156
Q9LHA8 650 Probable mediator of RNA yes no 1.0 0.429 0.928 1e-154
P24629 650 Heat shock cognate 70 kDa N/A no 1.0 0.429 0.931 1e-154
O65719 649 Heat shock 70 kDa protein no no 1.0 0.429 0.928 1e-154
P22953 651 Probable mediator of RNA no no 1.0 0.428 0.924 1e-153
P11143 645 Heat shock 70 kDa protein N/A no 0.989 0.427 0.938 1e-152
P22954 653 Probable mediator of RNA no no 1.0 0.427 0.913 1e-152
Q9C7X7 617 Heat shock 70 kDa protein no no 1.0 0.452 0.924 1e-152
P29357 653 Chloroplast envelope memb N/A no 1.0 0.427 0.906 1e-147
>sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 Back     alignment and function desciption
 Score =  559 bits (1440), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/279 (96%), Positives = 271/279 (97%)

Query: 1   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 60
           MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct: 1   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN 60

Query: 61  QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA 120
           QVAMNP NTVFDAKRLIGRRFSDPSVQSD+KLWPFKVI G GDKPMIVV YKGEEKQF+A
Sbjct: 61  QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA 120

Query: 121 EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 180
           EEISSMVL KMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEP
Sbjct: 121 EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP 180

Query: 181 TAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240
           TAAAIAYGLDKKA S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
Sbjct: 181 TAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query: 241 NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT 279
           NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT
Sbjct: 241 NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT 279

Petunia hybrida (taxid: 4102)
>sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 Back     alignment and function description
>sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 Back     alignment and function description
>sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 Back     alignment and function description
>sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 Back     alignment and function description
>sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 Back     alignment and function description
>sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 Back     alignment and function description
>sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=1 SV=1 Back     alignment and function description
>sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
242090773 649 hypothetical protein SORBIDRAFT_09g02258 0.992 0.426 0.967 1e-157
224098390 648 predicted protein [Populus trichocarpa] 1.0 0.430 0.964 1e-157
123650 651 RecName: Full=Heat shock cognate 70 kDa 1.0 0.428 0.960 1e-157
371779321 651 heat shock protein 70 isoform 3 [Solanum 1.0 0.428 0.964 1e-157
413949576 649 hypothetical protein ZEAMMB73_366749 [Ze 0.992 0.426 0.963 1e-156
45331281 649 70 kDa heat shock cognate protein 1 [Vig 1.0 0.429 0.960 1e-156
26985221 652 non-cell-autonomous heat shock cognate p 1.0 0.427 0.960 1e-156
762844 651 Hsc70 [Solanum lycopersicum] 1.0 0.428 0.964 1e-156
449449994 648 PREDICTED: heat shock cognate 70 kDa pro 1.0 0.430 0.949 1e-156
414879778 648 TPA: hypothetical protein ZEAMMB73_64856 0.992 0.427 0.960 1e-156
>gi|242090773|ref|XP_002441219.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor] gi|241946504|gb|EES19649.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor] Back     alignment and taxonomy information
 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 268/277 (96%), Positives = 272/277 (98%)

Query: 3   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 62
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct: 2   AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 61

Query: 63  AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEE 122
           AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKV+AG  DKPMIVVNYKGEEKQFSAEE
Sbjct: 62  AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPADKPMIVVNYKGEEKQFSAEE 121

Query: 123 ISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTA 182
           ISSMVL KMKEIAEAYLG+TIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTA
Sbjct: 122 ISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTA 181

Query: 183 AAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 242
           AAIAYGLDKKA S+GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct: 182 AAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR 241

Query: 243 MVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT 279
           MVNHFVQEFKRK+KKDISGNPRALRRLRTACERAKRT
Sbjct: 242 MVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRT 278

Source: Sorghum bicolor

Species: Sorghum bicolor

Genus: Sorghum

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224098390|ref|XP_002311161.1| predicted protein [Populus trichocarpa] gi|222850981|gb|EEE88528.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|123650|sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein gi|20557|emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida] Back     alignment and taxonomy information
>gi|371779321|emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|413949576|gb|AFW82225.1| hypothetical protein ZEAMMB73_366749 [Zea mays] Back     alignment and taxonomy information
>gi|45331281|gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata] Back     alignment and taxonomy information
>gi|26985221|gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita maxima] Back     alignment and taxonomy information
>gi|762844|gb|AAB42159.1| Hsc70 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|449449994|ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis sativus] gi|449483852|ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|414879778|tpg|DAA56909.1| TPA: hypothetical protein ZEAMMB73_648566 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2101222 650 HSP70 "heat shock protein 70" 1.0 0.429 0.928 2.8e-137
TAIR|locus:2074984 649 AT3G09440 [Arabidopsis thalian 1.0 0.429 0.928 1.5e-136
TAIR|locus:2181833 651 HSC70-1 "heat shock cognate pr 1.0 0.428 0.924 6.7e-136
TAIR|locus:2181818 653 Hsp70-2 [Arabidopsis thaliana 1.0 0.427 0.913 6e-135
TAIR|locus:2010713 617 ERD2 "EARLY-RESPONSIVE TO DEHY 1.0 0.452 0.924 7.7e-135
TAIR|locus:2200462 646 Hsp70b "heat shock protein 70B 0.996 0.430 0.863 2.9e-126
UNIPROTKB|Q7SX63 634 HSP70 "Heat shock protein 70" 0.982 0.432 0.836 3.1e-122
ZFIN|ZDB-GENE-040426-1221 647 hsc70 "heat shock cognate 70" 0.971 0.418 0.835 2e-120
DICTYBASE|DDB_G0269144 640 hspB "heat shock cognate prote 0.964 0.420 0.863 4.1e-120
UNIPROTKB|F1NRW7 647 HSPA8 "Heat shock cognate 71 k 0.971 0.418 0.839 1.8e-119
TAIR|locus:2101222 HSP70 "heat shock protein 70" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1344 (478.2 bits), Expect = 2.8e-137, P = 2.8e-137
 Identities = 259/279 (92%), Positives = 271/279 (97%)

Query:     1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 60
             MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct:     1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN 60

Query:    61 QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA 120
             QVAMNPTNTVFDAKRLIGRR+SDPSVQ+D   WPFKV++G G+KPMIVVN+KGEEKQFSA
Sbjct:    61 QVAMNPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVVSGPGEKPMIVVNHKGEEKQFSA 120

Query:   121 EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 180
             EEISSMVL KM+EIAEA+LG+ +KNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
Sbjct:   121 EEISSMVLIKMREIAEAFLGSPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 180

Query:   181 TAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240
             TAAAIAYGLDKKA S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
Sbjct:   181 TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240

Query:   241 NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT 279
             NRMVNHFVQEFKRKNKKDI+GNPRALRRLRTACERAKRT
Sbjct:   241 NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRT 279
GO:0005524 "ATP binding" evidence=IEA;IDA
GO:0005829 "cytosol" evidence=IDA;TAS
GO:0006457 "protein folding" evidence=RCA;TAS
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0009615 "response to virus" evidence=IEP
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0009644 "response to high light intensity" evidence=IEP;RCA
GO:0042542 "response to hydrogen peroxide" evidence=IEP;RCA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009617 "response to bacterium" evidence=IEP
GO:0016567 "protein ubiquitination" evidence=IMP
GO:0031625 "ubiquitin protein ligase binding" evidence=IPI
GO:0009266 "response to temperature stimulus" evidence=IEP
GO:0048046 "apoplast" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
TAIR|locus:2074984 AT3G09440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181833 HSC70-1 "heat shock cognate protein 70-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181818 Hsp70-2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010713 ERD2 "EARLY-RESPONSIVE TO DEHYDRATION 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200462 Hsp70b "heat shock protein 70B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7SX63 HSP70 "Heat shock protein 70" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1221 hsc70 "heat shock cognate 70" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269144 hspB "heat shock cognate protein Hsc70-1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRW7 HSPA8 "Heat shock cognate 71 kDa protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P08106HSP70_CHICKNo assigned EC number0.81810.98200.4321yesno
Q5B2V1HSP70_EMENINo assigned EC number0.82410.96770.4192yesno
P24629HSP71_SOLLCNo assigned EC number0.93181.00.4292N/Ano
P09446HSP7A_CAEELNo assigned EC number0.83760.96410.4203yesno
Q9LHA8MD37C_ARATHNo assigned EC number0.92831.00.4292yesno
P63018HSP7C_RATNo assigned EC number0.83570.97130.4195yesno
P63017HSP7C_MOUSENo assigned EC number0.83570.97130.4195yesno
P29357HSP7E_SPIOLNo assigned EC number0.90681.00.4272N/Ano
P19378HSP7C_CRIGRNo assigned EC number0.83210.97130.4195yesno
P27322HSP72_SOLLCNo assigned EC number0.95341.00.4332N/Ano
P36415HS7C1_DICDINo assigned EC number0.85600.96410.4203yesno
P09189HSP7C_PETHYNo assigned EC number0.96051.00.4285N/Ano
Q5NVM9HSP7C_PONABNo assigned EC number0.83570.97130.4195yesno
A2Q0Z1HSP7C_HORSENo assigned EC number0.83570.97130.4195yesno
P11143HSP70_MAIZENo assigned EC number0.93860.98920.4279N/Ano
P11142HSP7C_HUMANNo assigned EC number0.83570.97130.4195yesno
P19120HSP7C_BOVINNo assigned EC number0.83570.97130.4169yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Sb09g022580.1
hypothetical protein (650 aa)
(Sorghum bicolor)
Predicted Functional Partners:
Sb01g013390.1
hypothetical protein (420 aa)
  •  •  0.887
Sb06g024520.1
hypothetical protein (418 aa)
  •  •  0.886
Sb04g032970.1
hypothetical protein (420 aa)
  •  •  0.886
Sb09g018100.1
hypothetical protein (366 aa)
  •  •  0.880
Sb01g037890.2
annotation not avaliable (170 aa)
  •     0.486
Sb04g025770.1
hypothetical protein; Essential component of the PAM complex, a complex required for the transl [...] (336 aa)
• •   • 0.484
Sb01g041250.1
hypothetical protein (159 aa)
  •     0.483
Sb03g009120.1
hypothetical protein (212 aa)
  •     0.482
Sb04g033890.1
hypothetical protein (131 aa)
  •     0.478
Sb10g007480.1
hypothetical protein (453 aa)
  •     0.476

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
cd10233 376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 0.0
PTZ00009 653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 0.0
cd10241 374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 0.0
pfam00012 598 pfam00012, HSP70, Hsp70 protein 1e-176
PRK00290 627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 1e-138
cd10170 369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 1e-132
cd10234 376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 1e-130
cd11733 377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 1e-128
TIGR02350 595 TIGR02350, prok_dnaK, chaperone protein DnaK 1e-121
cd11734 373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 1e-116
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslatio 1e-115
cd10228 381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 1e-108
PTZ00400 663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 1e-107
CHL00094 621 CHL00094, dnaK, heat shock protein 70 1e-102
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 1e-101
PRK13410 668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 1e-100
PTZ00186 657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 2e-95
cd10235 339 cd10235, HscC_like_NBD, Nucleotide-binding domain 2e-95
PLN03184 673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 2e-89
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 3e-86
PRK05183 616 PRK05183, hscA, chaperone protein HscA; Provisiona 8e-85
cd10237 417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 2e-82
cd10238 375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 2e-81
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone H 1e-78
cd10230 388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 7e-70
cd10232 386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 1e-67
cd11739 383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 3e-67
cd11737 383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 1e-65
cd11732 377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 1e-60
cd11738 383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 1e-59
PRK01433 595 PRK01433, hscA, chaperone protein HscA; Provisiona 2e-48
cd10231 415 cd10231, YegD_like, Escherichia coli YegD, a putat 3e-19
cd10229 404 cd10229, HSPA12_like_NBD, Nucleotide-binding domai 3e-14
cd10225 320 cd10225, MreB_like, MreB and similar proteins 3e-07
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein 7e-07
PRK11678 450 PRK11678, PRK11678, putative chaperone; Provisiona 2e-06
PRK13928 336 PRK13928, PRK13928, rod shape-determining protein 2e-06
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, p 5e-06
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 6e-06
TIGR00904 333 TIGR00904, mreB, cell shape determining protein, M 9e-06
PRK15080267 PRK15080, PRK15080, ethanolamine utilization prote 2e-05
PRK13930 335 PRK13930, PRK13930, rod shape-determining protein 2e-05
PRK13929 335 PRK13929, PRK13929, rod-share determining protein 8e-05
pfam06723 327 pfam06723, MreB_Mbl, MreB/Mbl protein 2e-04
cd10227312 cd10227, ParM_like, Plasmid segregation protein Pa 0.002
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information 
 Score =  608 bits (1571), Expect = 0.0
 Identities = 237/271 (87%), Positives = 250/271 (92%), Gaps = 3/271 (1%)

Query: 9   AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTN 68
           AIGIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTN
Sbjct: 1   AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTN 60

Query: 69  TVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVL 128
           TVFDAKRLIGR+FSDP VQSDMK WPFKV+ G G  P+I V YKGE K F  EEISSMVL
Sbjct: 61  TVFDAKRLIGRKFSDPVVQSDMKHWPFKVVNGGGKPPII-VEYKGETKTFYPEEISSMVL 119

Query: 129 NKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYG 188
            KMKEIAEAYLG T+ NAV+TVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYG
Sbjct: 120 TKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYG 179

Query: 189 LDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFV 248
           LDKK G  GE+NVLIFDLGGGTFDVSLLTIE+GIFEVKATAGDTHLGGEDFDNR+VNHFV
Sbjct: 180 LDKKGG--GERNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFV 237

Query: 249 QEFKRKNKKDISGNPRALRRLRTACERAKRT 279
           QEFKRK+KKDISGN RALRRLRTACERAKRT
Sbjct: 238 QEFKRKHKKDISGNKRALRRLRTACERAKRT 268

This subfamily includes human HSPA1A (70-kDa heat shock protein 1A, also known as HSP72; HSPA1; HSP70I; HSPA1B; HSP70-1; HSP70-1A), HSPA1B (70-kDa heat shock protein 1B, also known as HSPA1A; HSP70-2; HSP70-1B), and HSPA1L (70-kDa heat shock protein 1-like, also known as HSP70T; hum70t; HSP70-1L; HSP70-HOM). The genes for these three HSPA1 proteins map in close proximity on the major histocompatibility complex (MHC) class III region on chromosome 6, 6p21.3. This subfamily also includes human HSPA8 (heat shock 70kDa protein 8, also known as LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; NIP71; HSPA10; the HSPA8 gene maps to 11q24.1), human HSPA2 (70-kDa heat shock protein 2, also known as HSP70-2; HSP70-3, the HSPA2 gene maps to 14q24.1), human HSPA6 (also known as heat shock 70kDa protein 6 (HSP70B') gi 94717614, the HSPA6 gene maps to 1q23.3), human HSPA7 (heat shock 70kDa protein 7 , also known as HSP70B; the HSPA7 gene maps to 1q23.3) and Saccharmoyces cerevisiae Stress-Seventy subfamily B/Ssb1p. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Associations of polymorphisms within the MHC-III HSP70 gene locus with longevity, systemic lupus erythematosus, Meniere's disease, noise-induced hearing loss, high-altitude pulmonary edema, and coronary heart disease, have been found. HSPA2 is involved in cancer cell survival, is required for maturation of male gametophytes, and is linked to male infertility. The induction of HSPA6 is a biomarker of cellular stress. HSPA8 participates in the folding and trafficking of client proteins to different subcellular compartments, and in the signal transduction and apoptosis process; it has been shown to protect cardiomyocytes against oxidative stress partly through an interaction with alpha-enolase. S. cerevisiae Ssb1p, is part of the ribosome-associated complex (RAC), it acts as a chaperone for nascent polypeptides, and is important for translation fidelity; Ssb1p is also a [PSI+] prion-curing factor. Length = 376
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins Back     alignment and domain information
>gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|236954 PRK11678, PRK11678, putative chaperone; Provisional Back     alignment and domain information
>gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|237564 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|212669 cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
KOG0100 663 consensus Molecular chaperones GRP78/BiP/KAR2, HSP 100.0
PTZ00009 653 heat shock 70 kDa protein; Provisional 100.0
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 100.0
PTZ00400 663 DnaK-type molecular chaperone; Provisional 100.0
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 100.0
PRK13410 668 molecular chaperone DnaK; Provisional 100.0
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 100.0
PRK13411 653 molecular chaperone DnaK; Provisional 100.0
PLN03184 673 chloroplast Hsp70; Provisional 100.0
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 100.0
CHL00094 621 dnaK heat shock protein 70 100.0
PRK05183 616 hscA chaperone protein HscA; Provisional 100.0
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 100.0
COG0443 579 DnaK Molecular chaperone [Posttranslational modifi 100.0
KOG0103 727 consensus Molecular chaperones HSP105/HSP110/SSE1, 100.0
KOG0101 620 consensus Molecular chaperones HSP70/HSC70, HSP70 100.0
PRK01433 595 hscA chaperone protein HscA; Provisional 100.0
KOG0102 640 consensus Molecular chaperones mortalin/PBP74/GRP7 100.0
KOG0104 902 consensus Molecular chaperones GRP170/SIL1, HSP70 100.0
PRK11678 450 putative chaperone; Provisional 100.0
PRK13929 335 rod-share determining protein MreBH; Provisional 99.96
PRK13928 336 rod shape-determining protein Mbl; Provisional 99.95
TIGR00904 333 mreB cell shape determining protein, MreB/Mrl fami 99.94
PF06723 326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 99.93
PRK13927 334 rod shape-determining protein MreB; Provisional 99.93
PRK13930 335 rod shape-determining protein MreB; Provisional 99.93
COG1077 342 MreB Actin-like ATPase involved in cell morphogene 99.91
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 99.82
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.74
PRK09472 420 ftsA cell division protein FtsA; Reviewed 99.54
COG0849 418 ftsA Cell division ATPase FtsA [Cell division and 99.53
cd00012 371 ACTIN Actin; An ubiquitous protein involved in the 99.52
smart00268 373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.52
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 99.5
PTZ00280 414 Actin-related protein 3; Provisional 99.35
COG4820277 EutJ Ethanolamine utilization protein, possible ch 99.32
PTZ00004 378 actin-2; Provisional 99.26
PF00022 393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.22
PTZ00281 376 actin; Provisional 99.22
PTZ00452 375 actin; Provisional 99.2
KOG0679 426 consensus Actin-related protein - Arp4p/Act3p [Cyt 99.19
PTZ00466 380 actin-like protein; Provisional 99.1
PRK10719 475 eutA reactivating factor for ethanolamine ammonia 99.0
TIGR03739320 PRTRC_D PRTRC system protein D. A novel genetic sy 99.0
PRK13917344 plasmid segregation protein ParM; Provisional 98.98
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 98.7
COG5277 444 Actin and related proteins [Cytoskeleton] 98.69
PF06406318 StbA: StbA protein; InterPro: IPR009440 This entry 98.56
PF06277 473 EutA: Ethanolamine utilisation protein EutA; Inter 98.34
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 98.21
KOG0797 618 consensus Actin-related protein [Cytoskeleton] 98.1
KOG0676 372 consensus Actin and related proteins [Cytoskeleton 98.08
KOG0681 645 consensus Actin-related protein - Arp5p [Cytoskele 98.05
PF07520 1002 SrfB: Virulence factor SrfB; InterPro: IPR009216 T 97.85
PRK11031 496 guanosine pentaphosphate phosphohydrolase; Provisi 97.82
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 97.67
PRK10854 513 exopolyphosphatase; Provisional 97.65
KOG0680 400 consensus Actin-related protein - Arp6p [Cytoskele 97.3
TIGR03706300 exo_poly_only exopolyphosphatase. It appears that 97.28
COG0248 492 GppA Exopolyphosphatase [Nucleotide transport and 97.21
KOG0677 389 consensus Actin-related protein Arp2/3 complex, su 97.1
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 97.01
COG4819 473 EutA Ethanolamine utilization protein, possible ch 96.99
COG4457 1014 SrfB Uncharacterized protein conserved in bacteria 96.7
PF02541285 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: I 96.44
COG1548 330 Predicted transcriptional regulator/sugar kinase [ 96.2
PF08841 332 DDR: Diol dehydratase reactivase ATPase-like domai 95.89
smart00842187 FtsA Cell division protein FtsA. FtsA is essential 95.71
KOG0678 415 consensus Actin-related protein Arp2/3 complex, su 95.1
COG5026 466 Hexokinase [Carbohydrate transport and metabolism] 95.05
PF08735254 DUF1786: Putative pyruvate format-lyase activating 94.61
PLN02405 497 hexokinase 94.16
PF14450120 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B 93.7
PLN02914 490 hexokinase 93.55
PLN02362 509 hexokinase 93.29
PF00349206 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo 93.24
PF01968 290 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPr 92.9
COG4012342 Uncharacterized protein conserved in archaea [Func 92.36
PLN02596 490 hexokinase-like 91.81
KOG1369 474 consensus Hexokinase [Carbohydrate transport and m 91.65
cd0600759 R3H_DEXH_helicase R3H domain of a group of protein 91.39
PTZ00107 464 hexokinase; Provisional 90.62
cd0264060 R3H_NRF R3H domain of the NF-kappaB-repression fac 90.21
PF00370245 FGGY_N: FGGY family of carbohydrate kinases, N-ter 90.07
smart0073299 YqgFc Likely ribonuclease with RNase H fold. YqgF 89.57
PF14450120 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B 88.68
COG1070 502 XylB Sugar (pentulose and hexulose) kinases [Carbo 88.41
PF00349206 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo 87.96
PF03652135 UPF0081: Uncharacterised protein family (UPF0081); 87.91
cd0264160 R3H_Smubp-2_like R3H domain of Smubp-2_like protei 87.6
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 87.08
PRK10331 470 L-fuculokinase; Provisional 86.83
PRK00109138 Holliday junction resolvase-like protein; Reviewed 86.1
PRK10939 520 autoinducer-2 (AI-2) kinase; Provisional 86.05
cd0263960 R3H_RRM R3H domain of mainly fungal proteins which 85.89
PRK00047 498 glpK glycerol kinase; Provisional 85.87
PTZ00294 504 glycerol kinase-like protein; Provisional 85.67
COG0145 674 HyuA N-methylhydantoinase A/acetone carboxylase, b 85.62
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 85.51
PRK15027 484 xylulokinase; Provisional 84.91
cd0264658 R3H_G-patch R3H domain of a group of fungal and pl 84.88
TIGR02259 432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 84.69
TIGR02628 465 fuculo_kin_coli L-fuculokinase. Members of this fa 84.64
PRK13317277 pantothenate kinase; Provisional 84.47
cd00529154 RuvC_resolvase Holliday junction resolvases (HJRs) 84.27
PRK04123 548 ribulokinase; Provisional 83.82
PLN02295 512 glycerol kinase 83.52
PRK13331251 pantothenate kinase; Reviewed 83.21
TIGR03123 318 one_C_unchar_1 probable H4MPT-linked C1 transfer p 82.48
TIGR01234 536 L-ribulokinase L-ribulokinase. This enzyme catalyz 82.14
COG0816141 Predicted endonuclease involved in recombination ( 81.63
TIGR01311 493 glycerol_kin glycerol kinase. This model describes 81.61
TIGR01314 505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 81.58
PLN02669 556 xylulokinase 81.1
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 80.93
>KOG0100 consensus Molecular chaperones GRP78/BiP/KAR2, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6.5e-55  Score=356.76  Aligned_cols=270  Identities=70%  Similarity=1.086  Sum_probs=260.6

Q ss_pred             CCCEEEEEcCCcceEEEEEeCCceEEEecCCCCcccceEEEEcCCceeecHHHHhhhhhCcCcccccchhhcCCCCCChh
Q 036208            6 EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPS   85 (279)
Q Consensus         6 ~~~vvGID~Gt~~t~v~~~~~~~~~~v~~~~~~~~~ps~i~~~~~~~~~G~~a~~~~~~~~~~~~~~~k~~l~~~~~~~~   85 (279)
                      ...|||||+||||++|+++.||.++++.|.+|+|.+||.++|.+.+|++|+.|..+...+|.+++.+.|+++|+.+++..
T Consensus        35 ~gtvigIdLGTTYsCVgV~kNgrvEIiANdQGNRItPSyVaFt~derLiGdAAKNQ~~~NPenTiFD~KRLIGr~~~d~~  114 (663)
T KOG0100|consen   35 LGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDDERLIGDAAKNQLTSNPENTIFDAKRLIGRKFNDKS  114 (663)
T ss_pred             cceEEEEecCCceeeEEEEeCCeEEEEecCCCCccccceeeeccchhhhhhHhhcccccCcccceechHHHhCcccCChh
Confidence            46799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhccccCCceEEecCCCcceEEEEeC-CceeeEeHHHHHHHHHHHHHHHHHHHhCCcccceEEeeCCCCCHHHHHHHHH
Q 036208           86 VQSDMKLWPFKVIAGAGDKPMIVVNYK-GEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKD  164 (279)
Q Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~isvP~~~~~~~r~~l~~  164 (279)
                      ++.+.+.+||+++. .++++.+++..+ ++...++|+++-+++|..+.+.|+.+++..+.+.+++||+||.+.||++.++
T Consensus       115 vq~Dik~~Pfkvv~-k~~kp~i~v~v~~g~~K~FtPeEiSaMiL~KMKe~AEayLGkkv~~AVvTvPAYFNDAQrQATKD  193 (663)
T KOG0100|consen  115 VQKDIKFLPFKVVN-KDGKPYIQVKVGGGETKVFTPEEISAMILTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKD  193 (663)
T ss_pred             hhhhhhcCceEEEc-CCCCccEEEEccCCcccccCHHHHHHHHHHHHHHHHHHHhCCcccceEEecchhcchHHHhhhcc
Confidence            99999999999876 566999999988 5678899999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCceeeeecchhHHHHHhhhccCCCCCCCeEEEEEEecCcceEEEEEeEeCCeEEEEEEeCCCCCchhHHHHHHH
Q 036208          165 AGVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMV  244 (279)
Q Consensus       165 a~~~ag~~~~~~i~e~~Aaa~~~~~~~~~~~~~~~~vlvvDiG~gttd~sv~~~~~~~~~~~~~~~~~~~Gg~~id~~l~  244 (279)
                      |-..||++.+++|.||+|||++|+.....   ....+||+|+||||+|+|++.+..+.+++++.+++..+||.++|+++.
T Consensus       194 AGtIAgLnV~RIiNePTaAAIAYGLDKk~---gEknilVfDLGGGTFDVSlLtIdnGVFeVlaTnGDThLGGEDFD~rvm  270 (663)
T KOG0100|consen  194 AGTIAGLNVVRIINEPTAAAIAYGLDKKD---GEKNILVFDLGGGTFDVSLLTIDNGVFEVLATNGDTHLGGEDFDQRVM  270 (663)
T ss_pred             cceeccceEEEeecCccHHHHHhcccccC---CcceEEEEEcCCceEEEEEEEEcCceEEEEecCCCcccCccchHHHHH
Confidence            99999999999999999999999998873   678999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhCCCCCCCHHHHHHHHHHHHhhhcC
Q 036208          245 NHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT  279 (279)
Q Consensus       245 ~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~aK~~  279 (279)
                      +|+.+.|+++.+++++.+.+++.+|+++||+||++
T Consensus       271 ~~fiklykkK~gkDv~kdnkA~~KLrRe~EkAKRa  305 (663)
T KOG0100|consen  271 EYFIKLYKKKHGKDVRKDNKAVQKLRREVEKAKRA  305 (663)
T ss_pred             HHHHHHHhhhcCCccchhhHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999985

>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0103 consensus Molecular chaperones HSP105/HSP110/SSE1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0101 consensus Molecular chaperones HSP70/HSC70, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>KOG0102 consensus Molecular chaperones mortalin/PBP74/GRP75, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0104 consensus Molecular chaperones GRP170/SIL1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>KOG0679 consensus Actin-related protein - Arp4p/Act3p [Cytoskeleton] Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>KOG0797 consensus Actin-related protein [Cytoskeleton] Back     alignment and domain information
>KOG0676 consensus Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>KOG0681 consensus Actin-related protein - Arp5p [Cytoskeleton] Back     alignment and domain information
>PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function Back     alignment and domain information
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>KOG0680 consensus Actin-related protein - Arp6p [Cytoskeleton] Back     alignment and domain information
>TIGR03706 exo_poly_only exopolyphosphatase Back     alignment and domain information
>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0677 consensus Actin-related protein Arp2/3 complex, subunit Arp2 [Cytoskeleton] Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>COG4819 EutA Ethanolamine utilization protein, possible chaperonin protecting lyase from inhibition [Amino acid transport and metabolism] Back     alignment and domain information
>COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] Back     alignment and domain information
>PF02541 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: IPR003695 Exopolyphosphate phosphatase (Ppx) 3 Back     alignment and domain information
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ] Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>KOG0678 consensus Actin-related protein Arp2/3 complex, subunit Arp3 [Cytoskeleton] Back     alignment and domain information
>COG5026 Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08735 DUF1786: Putative pyruvate format-lyase activating enzyme (DUF1786); InterPro: IPR014846 This family is annotated as pyruvate formate-lyase activating enzyme (1 Back     alignment and domain information
>PLN02405 hexokinase Back     alignment and domain information
>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T Back     alignment and domain information
>PLN02914 hexokinase Back     alignment and domain information
>PLN02362 hexokinase Back     alignment and domain information
>PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) Back     alignment and domain information
>PF01968 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3 Back     alignment and domain information
>COG4012 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PLN02596 hexokinase-like Back     alignment and domain information
>KOG1369 consensus Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases Back     alignment and domain information
>PTZ00107 hexokinase; Provisional Back     alignment and domain information
>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF) Back     alignment and domain information
>PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>smart00732 YqgFc Likely ribonuclease with RNase H fold Back     alignment and domain information
>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) Back     alignment and domain information
>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>cd02646 R3H_G-patch R3H domain of a group of fungal and plant proteins with unknown function, who also contain a G-patch domain Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>cd00529 RuvC_resolvase Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>PRK13331 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
3cqx_A 386 Chaperone Complex Length = 386 1e-135
3c7n_B 554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-134
3fzf_A 381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 1e-134
1hpm_A 386 How Potassium Affects The Activity Of The Molecular 1e-134
2qw9_B 394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 1e-134
1hx1_A 400 Crystal Structure Of A Bag Domain In Complex With T 1e-134
1ngb_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-134
1bup_A 386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 1e-134
1kaz_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 1e-134
1ngd_A 386 Structural Basis Of The 70-kilodalton Heat Shock Co 1e-134
1ngf_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-134
1ngh_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-134
1atr_A 386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-134
1nga_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-133
1yuw_A 554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 1e-133
1kax_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 1e-133
1ngg_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-133
1ngc_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-133
1nge_A 386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-133
1ats_A 386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-133
1kay_A 381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 1e-133
1ba0_A 386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-133
2bup_A 381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 1e-133
2qwn_A 394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 1e-133
1qqo_A 378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-133
1ba1_A 386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-133
2v7z_A 543 Crystal Structure Of The 70-Kda Heat Shock Cognate 1e-132
3jxu_A 409 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-132
2e8a_A 391 Crystal Structure Of The Human Hsp70 Atpase Domain 1e-132
2e88_A 391 Crystal Structure Of The Human Hsp70 Atpase Domain 1e-132
3i33_A 404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-132
3a8y_A 392 Crystal Structure Of The Complex Between The Bag5 B 1e-132
3d2f_B 382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 1e-132
1hjo_A 380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 1e-131
1s3x_A 382 The Crystal Structure Of The Human Hsp70 Atpase Dom 1e-131
1qqm_A 378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-131
3gdq_A 408 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-131
3kvg_A 400 Crystal Structure Of The N-Terminal Domain Of Hsp70 1e-130
1qqn_A 378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-130
3d2e_B 382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-129
4fsv_A 387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 1e-129
3fe1_A 403 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-126
3gl1_A 387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 1e-106
3ldl_A 384 Crystal Structure Of Human Grp78 (70kda Heat Shock 1e-105
3iuc_A 408 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-105
3qfp_A 390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 1e-102
3qfu_A 394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 1e-102
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 7e-79
1dkg_D 383 Crystal Structure Of The Nucleotide Exchange Factor 3e-78
4b9q_A 605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 2e-75
2v7y_A 509 Crystal Structure Of The Molecular Chaperone Dnak F 7e-70
3d2f_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 4e-44
3c7n_A 668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 4e-44
2qxl_A 658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 5e-44
3d2e_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 7e-43
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 7e-40
4gni_A 409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 5e-36
1jcf_A 344 Mreb From Thermotoga Maritima, Trigonal Length = 34 2e-05
1jce_A 344 Mreb From Thermotoga Maritima Length = 344 9e-05
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure 
Iteration: 1

 Score =  475 bits (1223), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 230/279 (82%), Positives = 249/279 (89%), Gaps = 3/279 (1%)
Query: 1   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 60
           M    +GPA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct: 3   MGSMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 62
Query: 61  QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA 120
           QVAMNPTNTVFDAKRLIGRRF D  VQSDMK WPF V+  AG +P + V YKGE K F  
Sbjct: 63  QVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAG-RPKVQVEYKGETKSFYP 121
Query: 121 EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 180
           EE+SSMVL KMKEIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG I+GLNV+RIINEP
Sbjct: 122 EEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEP 181
Query: 181 TAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240
           TAAAIAYGLDKK G+  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFD
Sbjct: 182 TAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFD 239
Query: 241 NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT 279
           NRMVNHF+ EFKRK+KKDIS N RA+RRLRTACERAKRT
Sbjct: 240 NRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRT 278
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|1JCF|A Chain A, Mreb From Thermotoga Maritima, Trigonal Length = 344 Back     alignment and structure
>pdb|1JCE|A Chain A, Mreb From Thermotoga Maritima Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 0.0
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 0.0
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 0.0
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 0.0
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 1e-144
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 1e-137
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 1e-123
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 2e-24
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 3e-18
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 2e-15
3js6_A355 Uncharacterized PARM protein; partition, segregati 7e-09
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 7e-08
1jce_A 344 ROD shape-determining protein MREB; MBL, actin, HS 8e-04
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
 Score =  652 bits (1684), Expect = 0.0
 Identities = 223/279 (79%), Positives = 245/279 (87%), Gaps = 1/279 (0%)

Query: 1   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 60
                  PAIGIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct: 17  NLYFQSMPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 76

Query: 61  QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA 120
           QVAMNPTNT+FDAKRLIGR+F D +VQSDMK WPF+V++  G KP + V YKGE K F  
Sbjct: 77  QVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSE-GGKPKVQVEYKGETKTFFP 135

Query: 121 EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP 180
           EEISSMVL KMKEIAEAYLG  + +AV+TVPAYFNDSQRQATKDAG I+GLNV+RIINEP
Sbjct: 136 EEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEP 195

Query: 181 TAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD 240
           TAAAIAYGLDKK  + GEKNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFD
Sbjct: 196 TAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFD 255

Query: 241 NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRT 279
           NRMV+H  +EFKRK+KKDI  N RA+RRLRTACERAKRT
Sbjct: 256 NRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRT 294
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Length = 344 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 100.0
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 100.0
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 100.0
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 100.0
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 100.0
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 100.0
4gni_A 409 Putative heat shock protein; HSP70-type ATPase, AT 100.0
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 100.0
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 100.0
1jce_A 344 ROD shape-determining protein MREB; MBL, actin, HS 99.96
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 99.8
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.8
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.76
2ych_A 377 Competence protein PILM; cell cycle, type IV pilus 99.67
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.65
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 99.6
4a2a_A 419 Cell division protein FTSA, putative; cell cycle, 99.57
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 99.55
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 99.49
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 99.43
3js6_A355 Uncharacterized PARM protein; partition, segregati 99.35
4fo0_A 593 Actin-related protein 8; chromatin remodeling, nuc 99.2
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 99.12
4ehu_A 276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 98.69
4am6_A 655 Actin-like protein ARP8; nuclear protein, chromati 98.53
2d0o_A 610 DIOL dehydratase-reactivating factor large subunit 98.25
1nbw_A 607 Glycerol dehydratase reactivase alpha subunit; mol 98.16
1t6c_A 315 Exopolyphosphatase; alpha/beta protein, actin-like 98.16
3mdq_A 315 Exopolyphosphatase; structural genomics, joint cen 97.85
3cer_A 343 Possible exopolyphosphatase-like protein; NESG, BL 97.82
1u6z_A 513 Exopolyphosphatase; alpha/beta protein, askha (ace 97.43
3hi0_A 508 Putative exopolyphosphatase; 17739545, structural 97.0
3aap_A 353 Ectonucleoside triphosphate diphosphohydrolase I; 96.25
3o8m_A 485 Hexokinase; rnaseh-like fold, glycolysis, glucose 94.47
2yhx_A 457 Hexokinase B; transferase(phosphoryl,alcohol accep 93.35
3ifr_A 508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 92.11
3vgl_A 321 Glucokinase; ROK family, transferase; HET: BGC ANP 92.03
3f9m_A 470 Glucokinase; hexokinase IV, ATP-binding, diabetes 91.36
4db3_A 327 Glcnac kinase, N-acetyl-D-glucosamine kinase; stru 90.94
3cj1_A 456 Ectonucleoside triphosphate diphosphohydrolase 2; 90.73
1bdg_A 451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 90.67
3hm8_A 445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 90.61
1nu0_A138 Hypothetical protein YQGF; structural genomics, st 90.07
3vov_A302 Glucokinase, hexokinase; ROK, sugar kinase, transf 90.04
1cza_N 917 Hexokinase type I; structurally homologous domains 89.75
2e2o_A 299 Hexokinase; acetate and sugar kinases, HSP70, acti 89.71
3r8e_A321 Hypothetical sugar kinase; ribonuclease H-like mot 89.38
4e1j_A 520 Glycerol kinase; structural genomics, PSI-biology, 89.34
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 89.04
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 88.85
4bc3_A 538 Xylulose kinase; transferase, glucuronate xyluloki 88.72
2ch5_A 347 NAGK protein; transferase, N-acetylglucosamine, gl 88.48
3h6e_A 482 Carbohydrate kinase, FGGY; novosphingobium aromati 88.18
3i8b_A 515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 88.03
2ap1_A 327 Putative regulator protein; zinc binding protein, 87.79
3ll3_A 504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 87.41
3l0q_A 554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 87.37
3ezw_A 526 Glycerol kinase; glycerol metabolism, allosteric r 87.14
3h3n_X 506 Glycerol kinase; ATP-binding, glycerol metabolism, 86.7
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 86.43
3hz6_A 511 Xylulokinase; xylulose, structural genomic, chromo 86.33
2p3r_A 510 Glycerol kinase; glycerol metabolism, allosteric r 85.36
2uyt_A 489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 85.29
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 85.07
3cet_A 334 Conserved archaeal protein; Q6M145, MRR63, NESG, X 83.57
3g25_A 501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 83.47
2zf5_O 497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 82.95
2dpn_A 495 Glycerol kinase; thermus thermophilus HB8, structu 82.79
2hoe_A380 N-acetylglucosamine kinase; TM1224, structural gen 82.63
1vhx_A150 Putative holliday junction resolvase; structural g 82.38
1hjr_A158 Holliday junction resolvase (RUVC); site-specific 81.96
2w40_A 503 Glycerol kinase, putative; closed conformation, ma 81.95
1z05_A 429 Transcriptional regulator, ROK family; structural 80.72
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
Probab=100.00  E-value=4e-50  Score=361.76  Aligned_cols=270  Identities=83%  Similarity=1.239  Sum_probs=252.3

Q ss_pred             CCCEEEEEcCCcceEEEEEeCCceEEEecCCCCcccceEEEEcCCceeecHHHHhhhhhCcCcccccchhhcCCCCCChh
Q 036208            6 EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPS   85 (279)
Q Consensus         6 ~~~vvGID~Gt~~t~v~~~~~~~~~~v~~~~~~~~~ps~i~~~~~~~~~G~~a~~~~~~~~~~~~~~~k~~l~~~~~~~~   85 (279)
                      ++.+||||||||||+|+++.+|.++++.++.|++.+||+|+|.++++++|..|..+...+|.+++.++|+++|+..+++.
T Consensus         3 m~~~iGIDlGTt~s~va~~~~g~~~ii~n~~g~~~~PS~V~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~~~d~~   82 (554)
T 1yuw_A            3 KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAV   82 (554)
T ss_dssp             SCCCEEEEECSSEEEEEEECSSSEEECCCTTSCSEEECCEEECSSCEEETHHHHTTTTTCGGGEECCGGGTTTCCSSCSH
T ss_pred             CCCEEEEEeCcccEEEEEEECCEEEEEECCCCCeecceEEEEcCCcEEEcHHHHHhhhhChhhehHhhHHhcCCCCCcHH
Confidence            45699999999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             HhhccccCCceEEecCCCcceEEEEeCCceeeEeHHHHHHHHHHHHHHHHHHHhCCcccceEEeeCCCCCHHHHHHHHHH
Q 036208           86 VQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDA  165 (279)
Q Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~isvP~~~~~~~r~~l~~a  165 (279)
                      ++...+.+|+.+.. .++++.+.+++.+....++|+++.+++|++|++.++.+++.++..+++|||++|++.||+++++|
T Consensus        83 v~~~~~~~p~~v~~-~~g~~~~~v~~~~~~~~~sp~ei~a~~L~~lk~~ae~~lg~~v~~~VitVPa~f~~~qr~a~~~A  161 (554)
T 1yuw_A           83 VQSDMKHWPFMVVN-DAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDA  161 (554)
T ss_dssp             HHHHHTTCSSEEEE-ETTEEEEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHSSCCCEEEEEECTTCCHHHHHHHHHH
T ss_pred             HHHHhhcCCeEEEe-cCCceEEEEEECCCceEEcHHHHHHHHHHHHHHHHHHHhCCCCCeEEEEECCCCCHHHHHHHHHH
Confidence            88888899998874 46788888888888889999999999999999999999998889999999999999999999999


Q ss_pred             HHHcCCceeeeecchhHHHHHhhhccCCCCCCCeEEEEEEecCcceEEEEEeEeCCeEEEEEEeCCCCCchhHHHHHHHH
Q 036208          166 GVISGLNVMRIINEPTAAAIAYGLDKKAGSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVN  245 (279)
Q Consensus       166 ~~~ag~~~~~~i~e~~Aaa~~~~~~~~~~~~~~~~vlvvDiG~gttd~sv~~~~~~~~~~~~~~~~~~~Gg~~id~~l~~  245 (279)
                      ++.||++.+.+++||+|||++|......  ..+..++|||+||||||++++++.++.+++++..++..+||.+||+.|.+
T Consensus       162 ~~~AGl~~~~li~EP~AAAlay~~~~~~--~~~~~vlV~D~GgGT~Dvsv~~~~~g~~~v~a~~g~~~lGG~d~d~~l~~  239 (554)
T 1yuw_A          162 GTIAGLNVLRIINEPTAAAIAYGLDKKV--GAERNVLIFDLGGGTFDVSILTIAAGIFEVKSTAGDTHLGGEDFDNRMVN  239 (554)
T ss_dssp             HHTTTCEEEEEEEHHHHHHHHTTCSTTC--SSCEEEEEEEECSSCEEEEEEEEETTEEEEEEEEEETTCSHHHHHHHHHH
T ss_pred             HHHcCCCeEEEeCcHHHHHHHHHhhccC--CCCcEEEEEEcCCCeEEEEEEEEcCCcEEEEEEeCCCCCCHHHHHHHHHH
Confidence            9999999999999999999999876541  25689999999999999999999999999999988899999999999999


Q ss_pred             HHHHHHHhhhCCCCCCCHHHHHHHHHHHHhhhc
Q 036208          246 HFVQEFKRKNKKDISGNPRALRRLRTACERAKR  278 (279)
Q Consensus       246 ~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~aK~  278 (279)
                      ++.++++++++.++..+++.+.+|+++||++|+
T Consensus       240 ~l~~~~~~~~~~~~~~~~~~~~~l~~~aE~~K~  272 (554)
T 1yuw_A          240 HFIAEFKRKHKKDISENKRAVRRLRTACERAKR  272 (554)
T ss_dssp             HHHHHHHHHTSCCTTSCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhCCCcccCHHHHHHHHHHHHHHhh
Confidence            999999999998888899999999999999997
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure
>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} Back     alignment and structure
>1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* Back     alignment and structure
>3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3aap_A Ectonucleoside triphosphate diphosphohydrolase I; adenosine triphosphatase, ntpdase; 1.60A {Legionella pneumophila} PDB: 3aaq_A* 3aar_A* Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* Back     alignment and structure
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Back     alignment and structure
>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} Back     alignment and structure
>3cj1_A Ectonucleoside triphosphate diphosphohydrolase 2; alpha/beta protein, actin-like fold, alternative splicing, calcium, glycoprotein, magnesium; 1.70A {Rattus norvegicus} PDB: 3cj7_A* 3cj9_A* 3cja_A* Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Back     alignment and structure
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Back     alignment and structure
>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A Back     alignment and structure
>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Back     alignment and structure
>1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 1e-89
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 2e-82
d1dkgd2 198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 3e-37
d1bupa2 193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 4e-36
d1jcea1137 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB 2e-29
d2zgya2163 c.55.1.1 (A:158-320) Plasmid segregation protein P 1e-13
d2fsja1161 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 2e-10
d1jcea2 196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 3e-09
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  261 bits (669), Expect = 1e-89
 Identities = 155/186 (83%), Positives = 166/186 (89%), Gaps = 1/186 (0%)

Query: 7   GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP 66
           GPA+GIDLG+TYSCVGV+QH +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP
Sbjct: 1   GPAVGIDLGSTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP 60

Query: 67  TNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSM 126
           TNTVFDAKRLIGRRF D  VQSDMK WPF V+  AG +P + V YKGE K F  EE+SSM
Sbjct: 61  TNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAG-RPKVQVEYKGETKSFYPEEVSSM 119

Query: 127 VLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIA 186
           VL KMKEIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIA
Sbjct: 120 VLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIA 179

Query: 187 YGLDKK 192
           YGLDKK
Sbjct: 180 YGLDKK 185
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 100.0
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 100.0
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.85
d1bupa2 193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.69
d1dkgd2 198 Heat shock protein 70kDa, ATPase fragment {Escheri 99.65
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 98.17
d1jcea2 196 Prokaryotic actin homolog MreB {Thermotoga maritim 98.14
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 98.1
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 97.96
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 97.87
d1e4ft2 191 Cell division protein FtsA {Thermotoga maritima [T 97.84
d1e4ft1193 Cell division protein FtsA {Thermotoga maritima [T 96.92
d2fsja2164 Hypothetical protein Ta0583 {Archaeon Thermoplasma 96.61
d1nbwa2239 ATPase domain of the glycerol dehydratase reactiva 96.56
d2ch5a2117 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 96.41
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 96.36
d1t6ca2 180 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 96.01
d1u6za3177 Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 95.55
d2zgya1157 Plasmid segregation protein ParM {Escherichia coli 94.38
d2p3ra1252 Glycerol kinase {Escherichia coli [TaxId: 562]} 93.74
d2fxua2 225 Actin {Cow (Bos taurus) [TaxId: 9913]} 93.47
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 93.44
d1k8ka2 258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 93.44
d1nbwa3 202 ATPase domain of the glycerol dehydratase reactiva 93.36
d1czan1207 Mammalian type I hexokinase {Human (Homo sapiens) 93.31
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 93.21
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli 93.09
d2d0oa3 203 Diol dehydratase-reactivating factor large subunit 93.0
d1woqa1129 Inorganic polyphosphate/ATP-glucomannokinase PPGMK 92.11
d1k8kb1 190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 92.1
d1ig8a1207 Hexokinase {Baker's yeast (Saccharomyces cerevisia 91.81
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 91.36
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 91.26
d1r59o1252 Glycerol kinase {Enterococcus casseliflavus [TaxId 90.65
d1iv0a_98 Hypothetical protein, YqgF homologue {Thermus ther 90.6
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli 90.15
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli 89.41
d1vhxa_140 Hypothetical protein YrrK (RuvX) {Bacillus subtili 88.68
d1czan3205 Mammalian type I hexokinase {Human (Homo sapiens) 88.16
d2gupa1114 Hypothetical protein SP2142 {Streptococcus pneumon 88.07
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhim 87.09
d1woqa1129 Inorganic polyphosphate/ATP-glucomannokinase PPGMK 86.66
d1u6za2124 Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 86.43
d1t6ca1126 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 85.71
d1ig8a1207 Hexokinase {Baker's yeast (Saccharomyces cerevisia 85.52
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 85.19
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhim 83.77
d1bdga1208 Hexokinase {Blood fluke (Schistosoma mansoni) [Tax 82.95
d2hoea3128 N-acetylglucosamine kinase {Thermotoga maritima [T 82.36
d1hjra_158 RuvC resolvase {Escherichia coli [TaxId: 562]} 82.33
d2d0oa2241 Diol dehydratase-reactivating factor large subunit 82.1
d1xrsb252 D-lysine 5,6-aminomutase beta subunit KamE, N-term 80.84
d1v4sa1205 Glucokinase {Human (Homo sapiens) [TaxId: 9606]} 80.4
d1czan3205 Mammalian type I hexokinase {Human (Homo sapiens) 80.26
d2gupa1114 Hypothetical protein SP2142 {Streptococcus pneumon 80.22
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=2.1e-37  Score=239.46  Aligned_cols=183  Identities=83%  Similarity=1.223  Sum_probs=171.4

Q ss_pred             CEEEEEcCCcceEEEEEeCCceEEEecCCCCcccceEEEEcCCceeecHHHHhhhhhCcCcccccchhhcCCCCCChhHh
Q 036208            8 PAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQ   87 (279)
Q Consensus         8 ~vvGID~Gt~~t~v~~~~~~~~~~v~~~~~~~~~ps~i~~~~~~~~~G~~a~~~~~~~~~~~~~~~k~~l~~~~~~~~~~   87 (279)
                      .+||||||||+|+||++.++.++++.++.+++.+||+|+|.++++++|..|......+|.++++++|+|+|....++...
T Consensus         2 ~vvGIDfGTt~s~va~~~~g~~~ii~~~~~~r~~Ps~i~~~~~~~~vG~~a~~~~~~~p~~~i~~~KrllG~~~~~~~~~   81 (185)
T d1bupa1           2 PAVGIDLGSTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQ   81 (185)
T ss_dssp             CCEEEEECSSEEEEEEEETTEEEECCCTTSCSSEECCEEECSSCEEETHHHHTTTTTCGGGEECCHHHHTTCCTTCHHHH
T ss_pred             CEEEEEcChhcEEEEEEECCEEEEEECCCCCccceeEEEECCCcEEEeechHHHhhcCcccchhHHHHHhCCCCccHHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccccCCceEEecCCCcceEEEEeCCceeeEeHHHHHHHHHHHHHHHHHHHhCCcccceEEeeCCCCCHHHHHHHHHHHH
Q 036208           88 SDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGV  167 (279)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~isvP~~~~~~~r~~l~~a~~  167 (279)
                      .....+++.... +.+.....+...+....++++++++++|++|++.++..++.++..+++|||++|+..||+++++||+
T Consensus        82 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~s~~el~a~~l~~l~~~a~~~~~~~~~~~VitvPa~f~~~qr~~~~~Aa~  160 (185)
T d1bupa1          82 SDMKHWPFMVVN-DAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGT  160 (185)
T ss_dssp             HHHTTCSSEEEE-ETTEEEEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHTSCCCEEEEEECTTCCHHHHHHHHHHHH
T ss_pred             HHhhcCCceEEc-CCCCccEEEEEcCCceEEcHHHHHHHHHHHHHHHHHHHhCCCcCcEEEEECCCCCHHHHHHHHHHHH
Confidence            888888887766 4567777888888888999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCceeeeecchhHHHHHhhhcc
Q 036208          168 ISGLNVMRIINEPTAAAIAYGLDK  191 (279)
Q Consensus       168 ~ag~~~~~~i~e~~Aaa~~~~~~~  191 (279)
                      .||++.+.+++||+|||++|..++
T Consensus       161 ~AGl~~~~li~EP~AAAl~Ygldk  184 (185)
T d1bupa1         161 IAGLNVLRIINEPTAAAIAYGLDK  184 (185)
T ss_dssp             HTTCEEEEEEEHHHHHHHHTTTTS
T ss_pred             HcCCCeEEEEcCHHHHHHHhcccC
Confidence            999999999999999999997643
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nbwa2 c.55.1.6 (A:2-91,A:257-405) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zgya1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1czan1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} Back     information, alignment and structure
>d1u6za2 c.55.1.8 (A:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bdga1 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d0oa2 c.55.1.6 (A:1-92,A:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1xrsb2 d.230.4.1 (B:33-84) D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure