Citrus Sinensis ID: 036215

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29

MRNPSSSSSSDGTKKITPCCSKVGIKKGPWTPEEDEILSNYIKREGEGQWRTLPKRAGLLRCGKSCRLRWMNYLRPSIKRGHIAPDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTRLRKKLISQGINPTTHKPLIFNQVVHDQLASSSSTSNPNTPSLEIMEEAGVSSTHQAAATNFTTNYNIPIDGGFMMGSLLPSSHGHGHNCIGDYIDNCDEDTFSSFLDSLVNDDDFMNHINEQQQQSSVSSYNNIGTIDWEFADVLSTKVGSDDQHGAAASLNDQL

cccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHcccccHHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccHHHHHHHcccccccccccccHHccccc

****************TPCCSKVGIKKGPWTPEEDEILSNYIKREGEGQWRTLPKRAGLLRCGKSCRLRWMNYLRPSIKRGHIAPDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTRLRKKLISQGINPTTHK********************************************************************HGHNCIGDYIDNCDEDTFSSFLDSLVNDDDFMNH***********S**NIGTIDWEFADVLSTKV****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription repressor MYB5	Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8.	probable	Q38850

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H8A, chain C
Confidence level:very confident
Coverage over the Query: 22-127
View the alignment between query and template
View the model in PyMOL

Template: 3ZQC, chain A
Confidence level:very confident
Coverage over the Query: 80-150
View the alignment between query and template
View the model in PyMOL