Citrus Sinensis ID: 036286


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MPSRLSDAFRAHPVFHQHKHLDFTSLQELPDSYAWTQRDEYPIGDSLISESVPVIDLNDPNALTLVGNACKTWGAFQVINHGIPTNLLDNTESTSRSLFSLPTQQKLKAARSPDGVAGYGLARISSFFSKLMWSEGFTVAGSPLDHFRKLWPQDFCKHCDIIEEYEQEMKKLAGRLMWLVLGSLGITTQDVKWAGPKGHFTDASAALQLNYYPACPDPDRAMGLAEHTDSTLLTILYQNNTSGLQVLKEGTGWVMVPPIPGALVVNVGDLIHILSNGSYPSVLHRAVVNRAKHRLSIAYLYGPPSSVQISPLQKLVGPSHPPLYRPITWSEYLDTKAKHFNKALSSVKSLLS
cccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccHHHHHHHHHHHHHccCEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHcccccccEEEEEccccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEccccEEEcccccccEEEEEccEEEEECcccccccccEEEEcccccEEEEEEEEccccccEECccccccccccccccccccHHHHHHHHHHHHHcccccHHHccc
***********HPVFHQHKHLDFTSLQELPDSYAWTQRDEYPIGDSLISESVPVIDLNDPNALTLVGNACKTWGAFQVINHGIPTNLLDNTESTSRSLFSLPTQQKL***RSPDGVAGYGLARISSFFSKLMWSEGFTVAGSPLDHFRKLWPQDFCKHCDIIEEYEQEMKKLAGRLMWLVLGSLGITTQDVKWAGPKGHFTDASAALQLNYYPACPDPDRAMGLAEHTDSTLLTILYQNNTSGLQVLKEGTGWVMVPPIPGALVVNVGDLIHILSNGSYPSVLHRAVVNRAKHRLSIAYLYGPPSSVQISPLQKLVGPSHPPLYRPITWSEYLDTKAKHFNKALSSVK**L*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSRLSDAFRAHPVFHQHKHLDFTSLQELPDSYAWTQRDEYPIGDSLISESVPVIDLNDPNALTLVGNACKTWGAFQVINHGIPTNLLDNTESTSRSLFSLPTQQKLKAARSPDGVAGYGLARISSFFSKLMWSEGFTVAGSPLDHFRKLWPQDFCKHCDIIEEYEQEMKKLAGRLMWLVLGSLGITTQDVKWAGPKGHFTDASAALQLNYYPACPDPDRAMGLAEHTDSTLLTILYQNNTSGLQVLKEGTGWVMVPPIPGALVVNVGDLIHILSNGSYPSVLHRAVVNRAKHRLSIAYLYGPPSSVQISPLQKLVGPSHPPLYRPITWSEYLDTKAKHFNKALSSVKSLLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gibberellin 3-beta-dioxygenase 1 Converts the inactive gibbberellin precursors GA9 and GA20 in the bioactives gibberellins GA4 and GA1.probableQ39103

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.11.-With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.probable
1.14.11.15Gibberellin 3-beta-dioxygenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OOX, chain A
Confidence level:very confident
Coverage over the Query: 49-340
View the alignment between query and template
View the model in PyMOL
Template: 1GP6, chain A
Confidence level:very confident
Coverage over the Query: 18-345
View the alignment between query and template
View the model in PyMOL