Citrus Sinensis ID: 036308

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MASGGGGGGSVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM
ccccccccccccccccccccccccEEEEEEEccEEEEEEEEEEccccccccHHHHHHHHcccccccccccCCccccccEEEcccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccccEEEcEEcccHHHHHHHHHcccccccccccccEEEEEcccc
**********************PIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNN*PKLACTIAECGEM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASGGGGGGSVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase H PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. May act as a chaperone.confidentO43447
Peptidyl-prolyl cis-trans isomerase H PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. May act as a chaperone.confidentQ0P5D0
Peptidyl-prolyl cis-trans isomerase H PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.confidentP0CP82

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z81, chain A
Confidence level:very confident
Coverage over the Query: 17-190
View the alignment between query and template
View the model in PyMOL