Citrus Sinensis ID: 036308

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MASGGGGGGSVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM
ccccccccccccccccccccccccEEEEEEEccEEEEEEEEEEccccccccHHHHHHHHcccccccccccEEccccccEEEcccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccccEEEcEEcccHHHHHHHHHHccccccccccccEEEEEcccc
cccccccccccccccccccccccEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHcccEEccEEccccccEccEEEcccEEEEccccccccccccccccccEcccccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHHcccEcHHHcEcccEEEEEEEEc
masggggggsvewhvrppnpknpivffdvtigtipagrikMELFADIAPKTAENFRQFCTGeyrkgglpvgykgcqFHRVIKDFMIQAGdflkgdgsgctsiyghkfddenfiakhtgpgllsmansgpnsngcqffitcakcdwldnkhVVFGRVLGDGLLVVRKIenvatgpnnrpklACTIAECGEM
masggggggsveWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKienvatgpnnrpklactiaecgem
MASggggggSVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM
**********************PIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMA****NSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNN*PKLACTI******
************************VFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVR****************CTIAECGEM
**********VEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM
********************KNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASGGGGGGSVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
O43447177 Peptidyl-prolyl cis-trans yes no 0.9 0.966 0.715 5e-71
Q0P5D0177 Peptidyl-prolyl cis-trans yes no 0.9 0.966 0.715 5e-71
P0C1I3178 Peptidyl-prolyl cis-trans N/A no 0.889 0.949 0.725 2e-70
P0CP82179 Peptidyl-prolyl cis-trans yes no 0.910 0.966 0.706 3e-67
P0CP83179 Peptidyl-prolyl cis-trans N/A no 0.910 0.966 0.706 3e-67
P52018183 Peptidyl-prolyl cis-trans yes no 0.9 0.934 0.697 4e-67
Q9D868188 Peptidyl-prolyl cis-trans no no 0.784 0.792 0.72 3e-61
Q4P6X6156 Peptidyl-prolyl cis-trans N/A no 0.815 0.993 0.666 1e-56
Q2TZ33181 Peptidyl-prolyl cis-trans yes no 0.878 0.922 0.631 9e-56
Q5AQL0183 Peptidyl-prolyl cis-trans yes no 0.878 0.912 0.625 2e-55
>sp|O43447|PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens GN=PPIH PE=1 SV=1 Back     alignment and function desciption
 Score =  266 bits (681), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 123/172 (71%), Positives = 146/172 (84%), Gaps = 1/172 (0%)

Query: 19  NPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFH 78
           +P NP+VFFDV+IG    GR+K+ELFAD+ PKTAENFRQFCTGE+RK G+P+GYKG  FH
Sbjct: 7   SPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFH 66

Query: 79  RVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFI 138
           RVIKDFMIQ GDF+ GDG+G  SIY   F DENF  +H+ PGLLSMANSGP++NGCQFFI
Sbjct: 67  RVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFI 126

Query: 139 TCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM 190
           TC+KCDWLD KHVVFG+++ DGLLV+RKIENV TGPNN+PKL   I++CGEM
Sbjct: 127 TCSKCDWLDGKHVVFGKII-DGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. May act as a chaperone.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q0P5D0|PPIH_BOVIN Peptidyl-prolyl cis-trans isomerase H OS=Bos taurus GN=PPIH PE=2 SV=1 Back     alignment and function description
>sp|P0C1I3|PPIH_RHIO9 Peptidyl-prolyl cis-trans isomerase H OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp7 PE=3 SV=1 Back     alignment and function description
>sp|P0CP82|PPIH_CRYNJ Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP3 PE=3 SV=1 Back     alignment and function description
>sp|P0CP83|PPIH_CRYNB Peptidyl-prolyl cis-trans isomerase H OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP3 PE=3 SV=1 Back     alignment and function description
>sp|P52018|CYP11_CAEEL Peptidyl-prolyl cis-trans isomerase 11 OS=Caenorhabditis elegans GN=cyn-11 PE=2 SV=1 Back     alignment and function description
>sp|Q9D868|PPIH_MOUSE Peptidyl-prolyl cis-trans isomerase H OS=Mus musculus GN=Ppih PE=2 SV=1 Back     alignment and function description
>sp|Q4P6X6|PPIH_USTMA Peptidyl-prolyl cis-trans isomerase H (Fragment) OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP3 PE=3 SV=2 Back     alignment and function description
>sp|Q2TZ33|PPIH_ASPOR Peptidyl-prolyl cis-trans isomerase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp3 PE=3 SV=1 Back     alignment and function description
>sp|Q5AQL0|PPIH_EMENI Peptidyl-prolyl cis-trans isomerase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp3 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
255543925196 peptidyl-prolyl cis-trans isomerase h, p 1.0 0.969 0.928 1e-102
449487118191 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.994 0.931 1e-100
224075876189 predicted protein [Populus trichocarpa] 0.994 1.0 0.936 1e-100
351723839194 uncharacterized protein LOC100305521 [Gl 1.0 0.979 0.915 2e-98
225465809189 PREDICTED: peptidyl-prolyl cis-trans iso 0.994 1.0 0.910 5e-98
217071014185 unknown [Medicago truncatula] gi|3885172 0.968 0.994 0.929 6e-98
357515287185 Peptidyl-prolyl cis-trans isomerase [Med 0.968 0.994 0.929 7e-98
388519765194 unknown [Lotus japonicus] 0.947 0.927 0.933 3e-96
388491428195 unknown [Lotus japonicus] 0.947 0.923 0.933 3e-96
346468925204 hypothetical protein [Amblyomma maculatu 0.957 0.892 0.895 1e-94
>gi|255543925|ref|XP_002513025.1| peptidyl-prolyl cis-trans isomerase h, ppih, putative [Ricinus communis] gi|223548036|gb|EEF49528.1| peptidyl-prolyl cis-trans isomerase h, ppih, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  374 bits (961), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/196 (92%), Positives = 185/196 (94%), Gaps = 6/196 (3%)

Query: 1   MASGGG------GGGSVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAEN 54
           MASG G      G G+VEWHVRPPNPKNPIVFFD+TIGTIPAGRIKMELFADIAPKTAEN
Sbjct: 1   MASGVGNTSTATGAGNVEWHVRPPNPKNPIVFFDITIGTIPAGRIKMELFADIAPKTAEN 60

Query: 55  FRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIA 114
           FRQFCTGEYRK GLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGC SIYGHKFDDENFIA
Sbjct: 61  FRQFCTGEYRKAGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCVSIYGHKFDDENFIA 120

Query: 115 KHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGP 174
           KHTGPGLLSMANSGPN+NGCQFFITCAKCDWLDNKHVVFGRV GDGLLVVRKIENVATGP
Sbjct: 121 KHTGPGLLSMANSGPNTNGCQFFITCAKCDWLDNKHVVFGRVHGDGLLVVRKIENVATGP 180

Query: 175 NNRPKLACTIAECGEM 190
           NNRPKLACTIAECGEM
Sbjct: 181 NNRPKLACTIAECGEM 196

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449487118|ref|XP_004157502.1| PREDICTED: peptidyl-prolyl cis-trans isomerase H-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224075876|ref|XP_002304808.1| predicted protein [Populus trichocarpa] gi|222842240|gb|EEE79787.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351723839|ref|NP_001236525.1| uncharacterized protein LOC100305521 [Glycine max] gi|356548841|ref|XP_003542807.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase H-like [Glycine max] gi|255625787|gb|ACU13238.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225465809|ref|XP_002262773.1| PREDICTED: peptidyl-prolyl cis-trans isomerase H [Vitis vinifera] gi|147792327|emb|CAN70281.1| hypothetical protein VITISV_022589 [Vitis vinifera] Back     alignment and taxonomy information
>gi|217071014|gb|ACJ83867.1| unknown [Medicago truncatula] gi|388517211|gb|AFK46667.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357515287|ref|XP_003627932.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355521954|gb|AET02408.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388519765|gb|AFK47944.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388491428|gb|AFK33780.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|346468925|gb|AEO34307.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
TAIR|locus:2064153199 AT2G38730 [Arabidopsis thalian 0.952 0.909 0.883 1.4e-89
UNIPROTKB|E1BXG0177 PPIH "Peptidyl-prolyl cis-tran 0.9 0.966 0.732 1.1e-69
UNIPROTKB|Q0P5D0177 PPIH "Peptidyl-prolyl cis-tran 0.9 0.966 0.715 2.7e-68
UNIPROTKB|E2R198177 PPIH "Peptidyl-prolyl cis-tran 0.9 0.966 0.715 2.7e-68
UNIPROTKB|O43447177 PPIH "Peptidyl-prolyl cis-tran 0.9 0.966 0.715 2.7e-68
UNIPROTKB|F1SF95177 PPIH "Peptidyl-prolyl cis-tran 0.9 0.966 0.709 1.2e-67
FB|FBgn0033089183 CG17266 [Drosophila melanogast 0.931 0.967 0.688 2.4e-67
WB|WBGene00000887183 cyn-11 [Caenorhabditis elegans 0.9 0.934 0.697 6.7e-65
ZFIN|ZDB-GENE-040625-127215 ppih "peptidylprolyl isomerase 0.810 0.716 0.754 8.8e-63
UNIPROTKB|I3L6I7188 PPIH "Peptidyl-prolyl cis-tran 0.852 0.861 0.680 2.4e-60
TAIR|locus:2064153 AT2G38730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 894 (319.8 bits), Expect = 1.4e-89, P = 1.4e-89
 Identities = 160/181 (88%), Positives = 169/181 (93%)

Query:    10 SVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLP 69
             +VEWHVRPPNPKNP+VFFDV+IG IPAGRIKMELFADIAPKTAENFRQFCTGE RK G P
Sbjct:    19 NVEWHVRPPNPKNPVVFFDVSIGGIPAGRIKMELFADIAPKTAENFRQFCTGELRKAGKP 78

Query:    70 VGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGP 129
             +GYK CQFHRVIKDFM+Q+GDFLK DGSGC SIYGHKF+DENF AKHTGPGLLSMANSGP
Sbjct:    79 LGYKECQFHRVIKDFMVQSGDFLKNDGSGCMSIYGHKFEDENFTAKHTGPGLLSMANSGP 138

Query:   130 NSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGE 189
             N+NGCQFFITCAKCDWLDNKHVVFGRVLGDGLLV+RKIENVA GPNNRPKLA  I ECGE
Sbjct:   139 NTNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVMRKIENVAIGPNNRPKLAVVITECGE 198

Query:   190 M 190
             M
Sbjct:   199 M 199
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0005773 "vacuole" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
UNIPROTKB|E1BXG0 PPIH "Peptidyl-prolyl cis-trans isomerase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P5D0 PPIH "Peptidyl-prolyl cis-trans isomerase H" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R198 PPIH "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43447 PPIH "Peptidyl-prolyl cis-trans isomerase H" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SF95 PPIH "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0033089 CG17266 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00000887 cyn-11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-127 ppih "peptidylprolyl isomerase H (cyclophilin H)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6I7 PPIH "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q39613CYPH_CATRO5, ., 2, ., 1, ., 80.58470.87890.9709N/Ano
O43447PPIH_HUMAN5, ., 2, ., 1, ., 80.71510.90.9661yesno
P0C1I3PPIH_RHIO95, ., 2, ., 1, ., 80.72510.88940.9494N/Ano
O74729PPIH_SCHPO5, ., 2, ., 1, ., 80.57050.87890.9653yesno
Q26516PPIE_SCHJA5, ., 2, ., 1, ., 80.56420.90520.9608N/Ano
O49886CYPH_LUPLU5, ., 2, ., 1, ., 80.58950.86840.9593N/Ano
Q4P6X6PPIH_USTMA5, ., 2, ., 1, ., 80.66660.81570.9935N/Ano
P21568CYPH_SOLLC5, ., 2, ., 1, ., 80.59060.87890.9766N/Ano
P21569CYPH_MAIZE5, ., 2, ., 1, ., 80.56140.87890.9709N/Ano
Q7SG06PPIH_NEUCR5, ., 2, ., 1, ., 80.60450.90520.9450N/Ano
Q0P5D0PPIH_BOVIN5, ., 2, ., 1, ., 80.71510.90.9661yesno
P0C1H7PPIA1_RHIO95, ., 2, ., 1, ., 80.60350.85260.9878N/Ano
P52018CYP11_CAEEL5, ., 2, ., 1, ., 80.69760.90.9344yesno
P73789PPI2_SYNY35, ., 2, ., 1, ., 80.57980.85780.9532N/Ano
P24525CYPH_BRANA5, ., 2, ., 1, ., 80.56720.87890.9766N/Ano
Q5AQL0PPIH_EMENI5, ., 2, ., 1, ., 80.62570.87890.9125yesno
P0CP83PPIH_CRYNB5, ., 2, ., 1, ., 80.70680.91050.9664N/Ano
P0CP82PPIH_CRYNJ5, ., 2, ., 1, ., 80.70680.91050.9664yesno
Q01490PPIB_ORPSP5, ., 2, ., 1, ., 80.54330.87360.8177N/Ano
Q4WCM6PPIH_ASPFU5, ., 2, ., 1, ., 80.59110.93150.9779yesno
Q4IPH4PPIH_GIBZE5, ., 2, ., 1, ., 80.59880.90520.9450yesno
Q2TZ33PPIH_ASPOR5, ., 2, ., 1, ., 80.63150.87890.9226yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.976
4th Layer5.2.1.80.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_III1703
hypothetical protein; PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity) (189 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 1e-147
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 1e-111
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 1e-72
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 3e-57
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 2e-54
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 2e-54
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 1e-50
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 6e-45
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 1e-44
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 6e-43
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 4e-40
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 3e-29
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 6e-26
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 3e-18
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 3e-14
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 3e-10
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 3e-05
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information 
 Score =  406 bits (1044), Expect = e-147
 Identities = 168/186 (90%), Positives = 176/186 (94%)

Query: 5   GGGGGSVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYR 64
             G G+VEWH+RPPNPKNP+VFFDVTIG IPAGRIKMELFADIAPKTAENFRQFCTGE+R
Sbjct: 1   SAGAGNVEWHLRPPNPKNPVVFFDVTIGGIPAGRIKMELFADIAPKTAENFRQFCTGEFR 60

Query: 65  KGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSM 124
           K GLP GYKGCQFHRVIKDFMIQ GDFLKGDG+GC SIYG KF+DENFIAKHTGPGLLSM
Sbjct: 61  KAGLPQGYKGCQFHRVIKDFMIQGGDFLKGDGTGCVSIYGSKFEDENFIAKHTGPGLLSM 120

Query: 125 ANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTI 184
           ANSGPN+NGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLAC I
Sbjct: 121 ANSGPNTNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACVI 180

Query: 185 AECGEM 190
           +ECGEM
Sbjct: 181 SECGEM 186

Length = 186
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PTZ00060183 cyclophilin; Provisional 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00221249 cyclophilin; Provisional 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
KOG0883518 consensus Cyclophilin type, U box-containing pepti 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.59
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 97.06
PRK00969 508 hypothetical protein; Provisional 97.01
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 96.8
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 96.73
PRK00969508 hypothetical protein; Provisional 96.14
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 93.99
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 93.98
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=5.7e-60  Score=390.80  Aligned_cols=172  Identities=59%  Similarity=0.994  Sum_probs=166.5

Q ss_pred             CCCCCCeEEEEEEeCceeceeEEEEEcCCCChhHHHHHHHHHcCccc---cCCCcccccCceEEEEEcCceeeeccccCC
Q 036308           18 PNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYR---KGGLPVGYKGCQFHRVIKDFMIQAGDFLKG   94 (190)
Q Consensus        18 ~~~~~~~v~~di~v~~~~~G~ivieL~~~~aP~~~~nF~~l~~~~~~---~~~~~~~Y~g~~f~ri~~~~~iqgGd~~~~   94 (190)
                      +...+|+|||||++++.+.|||+||||.|.||+||+||..||+|..|   ..+++++|+|+.||||+++|||||||+..+
T Consensus         4 ~~~~~pr~ffDISI~ge~~GRIvfeLf~dv~PKTaENFraLCtGE~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~g   83 (372)
T KOG0546|consen    4 SVRTNPRVFFDISIGGEPAGRIVFELFNDVVPKTAENFRALCTGEKGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEG   83 (372)
T ss_pred             ccCCCceEEEEEEeCCcccceEEEEeecccCchhHHHHHHHhccccCCCCCCCCeeeecCchhheeeecceeeccccccC
Confidence            33479999999999999999999999999999999999999999987   456889999999999999999999999999


Q ss_pred             CCCCccccCCccCCCCcccccCCCCcEEEEeecCCCCCcceEEEecCCCCCCCCCceEEEEEEcchHHHHHHHHcCcCCC
Q 036308           95 DGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGP  174 (190)
Q Consensus        95 ~g~~~~~~~~~~~~~e~~~~~h~~~G~vs~~~~~~~~~~sqFfItl~~~~~ld~~~~vfG~Vi~~G~~vl~~I~~~~~~~  174 (190)
                      +|+|+.||||..|+||++.++|+++++|||||.+||+|+||||||+.++||||+.|+|||+|| .|++|++.|+.+.++.
T Consensus        84 nGtGGeSIYG~~FdDEnF~lKHdrpflLSMAN~GpNTNgSQFFITT~p~PHLdGkHVVFGqVI-~G~~VVr~IEn~~~d~  162 (372)
T KOG0546|consen   84 NGTGGESIYGEKFDDENFELKHDRPFLLSMANRGPNTNGSQFFITTVPTPHLDGKHVVFGQVI-KGKEVVREIENLETDE  162 (372)
T ss_pred             CCCCcccccccccccccceeccCcchhhhhhcCCCCCCCcceEEeCCCCCCcCCceeEEeeEe-echhHHHHHhcccccc
Confidence            999999999999999999999999999999999999999999999999999999999999999 9999999999999999


Q ss_pred             CCCCCCCeEEeeeeeC
Q 036308          175 NNRPKLACTIAECGEM  190 (190)
Q Consensus       175 ~~~P~~~i~I~~cG~l  190 (190)
                      ..+|..+|.|.+||+|
T Consensus       163 ~skP~~dV~I~dCGel  178 (372)
T KOG0546|consen  163 ESKPLADVVISDCGEL  178 (372)
T ss_pred             CCCCccceEecccccc
Confidence            9999999999999997

>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 3e-72
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 2e-61
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 7e-51
1dyw_A173 Biochemical And Structural Characterization Of A Di 2e-50
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 5e-50
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 6e-50
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 7e-50
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 9e-50
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 1e-48
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 1e-47
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 2e-47
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 2e-47
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 3e-47
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 3e-47
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 3e-47
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 3e-47
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 5e-47
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 6e-47
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 1e-46
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 1e-46
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 2e-46
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 2e-46
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 2e-46
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 2e-46
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 2e-46
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 2e-46
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 2e-46
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 3e-46
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 4e-46
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 6e-46
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 6e-46
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 8e-46
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 1e-45
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 2e-45
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 3e-45
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 3e-45
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 4e-45
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 4e-45
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 4e-45
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 5e-45
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 5e-44
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 2e-43
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 6e-43
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 7e-43
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 1e-42
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 1e-42
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 2e-42
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 5e-42
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 1e-41
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 1e-41
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 2e-41
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 8e-38
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 9e-38
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 6e-37
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 1e-28
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 1e-28
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 1e-28
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 4e-26
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 1e-25
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 2e-25
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 2e-25
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 2e-24
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 4e-23
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 9e-23
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 5e-20
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 9e-19
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 1e-17
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 1e-14
2ose_A234 Crystal Structure Of The Mimivirus Cyclophilin Leng 5e-14
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 3e-11
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 7e-10
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 4e-09
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 4e-09
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 1e-06
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 1e-06
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure 
Iteration: 1

 Score =  267 bits (682), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 123/172 (71%), Positives = 146/172 (84%), Gaps = 1/172 (0%)
Query: 19  NPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFH 78
           +P NP+VFFDV+IG    GR+K+ELFAD+ PKTAENFRQFCTGE+RK G+P+GYKG  FH
Sbjct: 7   SPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFH 66
Query: 79  RVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFI 138
           RVIKDFMIQ GDF+ GDG+G  SIY   F DENF  +H+ PGLLSMANSGP++NGCQFFI
Sbjct: 67  RVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFI 126
Query: 139 TCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM 190
           TC+KCDWLD KHVVFG+++ DGLLV+RKIENV TGPNN+PKL   I++CGEM
Sbjct: 127 TCSKCDWLDGKHVVFGKII-DGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|2OSE|A Chain A, Crystal Structure Of The Mimivirus Cyclophilin Length = 234 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 1e-117
1z81_A229 Cyclophilin; structural genomics, structural genom 1e-116
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 1e-114
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 1e-113
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 1e-113
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-112
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-109
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-108
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 1e-108
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-106
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 1e-106
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 1e-106
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 1e-105
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 1e-104
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-102
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 1e-102
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 1e-101
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 1e-100
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 1e-99
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 5e-73
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 1e-72
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 8e-72
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 1e-70
2b71_A196 Cyclophilin-like protein; structural genomics, str 3e-69
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 8e-69
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 3e-67
2hq6_A185 Serologically defined colon cancer antigen 10; pro 4e-67
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 1e-63
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 3e-61
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 3e-60
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 4e-58
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 3e-37
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 4e-37
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 8e-37
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 1e-30
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
 Score =  329 bits (847), Expect = e-117
 Identities = 123/174 (70%), Positives = 146/174 (83%), Gaps = 1/174 (0%)

Query: 17  PPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQ 76
             +P NP+VFFDV+IG    GR+K+ELFAD+ PKTAENFRQFCTGE+RK G+P+GYKG  
Sbjct: 5   NSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGST 64

Query: 77  FHRVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQF 136
           FHRVIKDFMIQ GDF+ GDG+G  SIY   F DENF  +H+ PGLLSMANSGP++NGCQF
Sbjct: 65  FHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQF 124

Query: 137 FITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM 190
           FITC+KCDWLD KHVVFG+++ DGLLV+RKIENV TGPNN+PKL   I++CGEM
Sbjct: 125 FITCSKCDWLDGKHVVFGKII-DGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
3kop_A188 Uncharacterized protein; protein with A cyclophili 94.21
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
Probab=100.00  E-value=2e-56  Score=345.95  Aligned_cols=173  Identities=71%  Similarity=1.313  Sum_probs=164.6

Q ss_pred             CCCCCCCeEEEEEEeCceeceeEEEEEcCCCChhHHHHHHHHHcCccccCCCcccccCceEEEEEcCceeeeccccCCCC
Q 036308           17 PPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDG   96 (190)
Q Consensus        17 ~~~~~~~~v~~di~v~~~~~G~ivieL~~~~aP~~~~nF~~l~~~~~~~~~~~~~Y~g~~f~ri~~~~~iqgGd~~~~~g   96 (190)
                      ..++.+|+||||++++++++|+|+||||++.||+||+||++||+++++..+++++|+++.|||++|+|+|||||+..++|
T Consensus         5 ~~~~~~~~v~~di~i~~t~~G~i~ieL~~~~aP~t~~NF~~L~~~~~g~~g~~~~Y~g~~FhRvi~~f~iQgGd~~~~~G   84 (177)
T 1mzw_A            5 NSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDG   84 (177)
T ss_dssp             CCCCCCCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTCCEETTEECSSTTCBCCEEETTTEEEECCTTTSSS
T ss_pred             ccCCCCCEEEEEEEECCeeceeEEEEEcCCCCcHHHHHHHHHHhcccCCcCccceECCCEEEEEECCCEEEcCCcccCCC
Confidence            35678999999999999999999999999999999999999999988544556779999999999999999999988889


Q ss_pred             CCccccCCccCCCCcccccCCCCcEEEEeecCCCCCcceEEEecCCCCCCCCCceEEEEEEcchHHHHHHHHcCcCCCCC
Q 036308           97 SGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNN  176 (190)
Q Consensus        97 ~~~~~~~~~~~~~e~~~~~h~~~G~vs~~~~~~~~~~sqFfItl~~~~~ld~~~~vfG~Vi~~G~~vl~~I~~~~~~~~~  176 (190)
                      .++.++|+..|++|+..++|+++|+||||+.+|++++|||||++.++|+||++|+|||+|+ +|||||++|+++++++++
T Consensus        85 ~gg~si~g~~f~dE~~~l~h~~~G~lsmAn~gp~tngSQFfIt~~~~~~LDg~~~VFG~Vv-~G~dvv~~I~~~~t~~~~  163 (177)
T 1mzw_A           85 TGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKII-DGLLVMRKIENVPTGPNN  163 (177)
T ss_dssp             CCCCCTTSSCBCCCCCCSCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEE-ECHHHHHHHHTSCBCGGG
T ss_pred             CCCCccCCCcccCcccccccCCCCEEEEccCCCCCcceEEEEECCCCCccCCCeeEEEEEe-CCHHHHHHHHhCCcCCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999 999999999999999899


Q ss_pred             CCCCCeEEeeeeeC
Q 036308          177 RPKLACTIAECGEM  190 (190)
Q Consensus       177 ~P~~~i~I~~cG~l  190 (190)
                      +|.++|+|.+||+|
T Consensus       164 ~P~~~v~I~~cG~l  177 (177)
T 1mzw_A          164 KPKLPVVISQCGEM  177 (177)
T ss_dssp             CBSSCEEEEEEEEC
T ss_pred             CCCCCEEEEeceeC
Confidence            99999999999997
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 6e-58
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 7e-57
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 6e-55
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 7e-54
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 2e-52
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 5e-52
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 2e-51
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 3e-48
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 5e-48
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 1e-47
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 1e-46
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 4e-46
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 9e-46
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 2e-45
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 3e-42
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-37
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 1e-35
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 4e-33
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 7e-33
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 8e-29
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-27
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 6e-26
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]

 Score =  177 bits (450), Expect = 6e-58
 Identities = 123/172 (71%), Positives = 146/172 (84%), Gaps = 1/172 (0%)

Query: 19  NPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFH 78
           +P NP+VFFDV+IG    GR+K+ELFAD+ PKTAENFRQFCTGE+RK G+P+GYKG  FH
Sbjct: 3   SPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFH 62

Query: 79  RVIKDFMIQAGDFLKGDGSGCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFI 138
           RVIKDFMIQ GDF+ GDG+G  SIY   F DENF  +H+ PGLLSMANSGP++NGCQFFI
Sbjct: 63  RVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFI 122

Query: 139 TCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNRPKLACTIAECGEM 190
           TC+KCDWLD KHVVFG+++ DGLLV+RKIENV TGPNN+PKL   I++CGEM
Sbjct: 123 TCSKCDWLDGKHVVFGKII-DGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 173
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1x7fa1117 Outer surface protein, C-terminal domain {Bacillus 83.01
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]

Probab=100.00  E-value=1.8e-50  Score=310.17  Aligned_cols=172  Identities=72%  Similarity=1.322  Sum_probs=159.1

Q ss_pred             CCCCCCeEEEEEEeCceeceeEEEEEcCCCChhHHHHHHHHHcCccccCCCcccccCceEEEEEcCceeeeccccCCCCC
Q 036308           18 PNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKGGLPVGYKGCQFHRVIKDFMIQAGDFLKGDGS   97 (190)
Q Consensus        18 ~~~~~~~v~~di~v~~~~~G~ivieL~~~~aP~~~~nF~~l~~~~~~~~~~~~~Y~g~~f~ri~~~~~iqgGd~~~~~g~   97 (190)
                      +++.||+|||||+++++++|+|+||||.+.||++|+||++||+.++.......+|+++.|||++|++++|+|+...+.+.
T Consensus         2 ~~~~np~v~~di~i~~~~~G~i~ieL~~~~aP~tv~nF~~L~~~~~~~~~~~~~y~~~~f~rv~~~~~~q~G~~~~~~~~   81 (173)
T d1qoia_           2 SSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGT   81 (173)
T ss_dssp             CSCCCCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHSCCEETTEECSSTTCBCCEEETTTEEEECCTTTSSSC
T ss_pred             CCCCCCEEEEEEEECCEeCeEEEEEEcCCCCcHHHHHHHHhhcccccccCCCCCcCCcccceeccceeeccCCcccCCcc
Confidence            46789999999999999999999999999999999999999999875555566799999999999999999998776666


Q ss_pred             CccccCCccCCCCcccccCCCCcEEEEeecCCCCCcceEEEecCCCCCCCCCceEEEEEEcchHHHHHHHHcCcCCCCCC
Q 036308           98 GCTSIYGHKFDDENFIAKHTGPGLLSMANSGPNSNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPNNR  177 (190)
Q Consensus        98 ~~~~~~~~~~~~e~~~~~h~~~G~vs~~~~~~~~~~sqFfItl~~~~~ld~~~~vfG~Vi~~G~~vl~~I~~~~~~~~~~  177 (190)
                      .....+..++.++.....|+.+|+|+|+++++++++|||||++.+.|+||++|+|||+|+ +|||||++|++++++++++
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~G~l~ma~~~~~s~~sqFfI~~~~~~~ldg~~tvFG~Vi-~G~dvl~~I~~~~t~~~~~  160 (173)
T d1qoia_          82 GVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKII-DGLLVMRKIENVPTGPNNK  160 (173)
T ss_dssp             CCCCTTSSCBCCCCCCSCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEE-ECHHHHHHHHTSCBCGGGC
T ss_pred             eeecccCCcccccccccccCCCcEEEeeecCCCCCCceeeeeccCCccCCcceeEEEEEe-chHHHHHHHHhCCcCCCCc
Confidence            666667777888888888888999999999999999999999999999999999999999 9999999999999999999


Q ss_pred             CCCCeEEeeeeeC
Q 036308          178 PKLACTIAECGEM  190 (190)
Q Consensus       178 P~~~i~I~~cG~l  190 (190)
                      |+++|+|++||+|
T Consensus       161 P~~~i~I~~cGel  173 (173)
T d1qoia_         161 PKLPVVISQCGEM  173 (173)
T ss_dssp             BSSCEEEEEEEEC
T ss_pred             CCCCEEEEcccCC
Confidence            9999999999997
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7fa1 b.62.1.2 (A:245-361) Outer surface protein, C-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure