Citrus Sinensis ID: 036344

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGKQRKEQQARRGNSCLKQEMIKREIDQTTSVVPAVAGIDIMMNNQTPYWPELPFVTPPLVSSQQDQSSLKDLLIKLGGRFCDGDHHQQSITAACPFDASLAQSQDDQLLYDSNTMSLLSIASPTSMNISSTQLPNTQYNVIGAAPNMSQGLANFPFEQLNDQYVAYTNNHQQLEELERLYVSGSTTGNSTSADQSSSWEDMSSLVYSTMVSDYETCQQSVPQDSTSFEDERYFGHQ
ccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHccccHHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHcccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccc
cccccccHHcccccccccHHHHHHHHHHHHHccccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHccccccccccccHHHcccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccEEcccccccccccEEccccccccHHHHcccccc
mgrapccdkanvkkgpwspeeDAKLKAYIEQhgtggnwialphkiglkrcgksCRLRWLNylrpnikhggfseeeDNIICSLYISIGSRWSIIAaqlpgrtdndiknYWNTRLKKKLLGKQRKEQQARRGNSCLKQEMIKREIdqttsvvpavagidimmnnqtpywpelpfvtpplvssqqdQSSLKDLLIKLggrfcdgdhhqqsitaacpfdaslaqsqddqllydsntmsllsiasptsmnisstqlpntqynvigaapnmsqglanfpfeqlNDQYVAYTNNHQQLEELERLYVsgsttgnstsadqsssweDMSSLVYSTMVSdyetcqqsvpqdstsfederyfghq
mgrapccdkanvkkgpwspeEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPnikhggfseeEDNIICSLYISIGSRWSIIAAQlpgrtdndiknyWNTRLKkkllgkqrkeqqarrgnsclkqemikreidqttsVVPAVAGIDIMMNNQTPYWPELPFVTPPLVSSQQDQSSLKDLLIKLGGRFCDGDHHQQSITAACPFDASLAQSQDDQLLYDSNTMSLLSIASPTSMNISSTQLPNTQYNVIGAAPNMSQGLANFPFEQLNDQYVAYTNNHQQLEELERLYVSGSTTgnstsadqsssweDMSSLVYSTMVSDYETCQQsvpqdstsfedERYFGHQ
MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRlkkkllgkqrkeqqARRGNSCLKQEMIKREIDQTTSVVPAVAGIDIMMNNQTPYWPELPFVTPPlvssqqdqsslkdllIKLGGRFCDGDHHQQSITAACPFDASLAQSQDDQLLYDSNTMSLLSIASPTSMNISSTQLPNTQYNVIGAAPNMSQGLANFPFEQLNDQYVAYTNNHQQLEELERLYVSGSTTGNSTSADQSSSWEDMSSLVYSTMVSDYETCQQSVPQDSTSFEDERYFGHQ
************************LKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKL***********************REIDQTTSVVPAVAGIDIMMNNQTPYWPELPFVTPPLV********LKDLLIKLGGRFCDGDHHQQSITAACPFDAS*********LY**************************QYNVIGAAPNMSQGLANFPFEQLNDQYVAYTNNHQQLEELERLY********************************************************
*GRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLK***********************************************************************************************************************************************************************VAYTNN*QQL*******************************V**TMVSDYETCQQSVPQDSTSFEDERYFG**
MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKL**************SCLKQEMIKREIDQTTSVVPAVAGIDIMMNNQTPYWPELPFVTPP*********SLKDLLIKLGGRFCDGDHHQQSITAACPFDASLAQSQDDQLLYDSNTMSLLSIASPTSMNISSTQLPNTQYNVIGAAPNMSQGLANFPFEQLNDQYVAYTNNHQQLEELERLYVSG****************DMSSLVYSTMVSDYETCQQSVPQDSTSFEDERYFGHQ
***APCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGKQR**************************************************************************************TAACPFDASLAQSQDDQLLYDSNTMSLLSIASPTSMNISSTQLPNTQYNVIGAAPNMSQGLANFPFEQLNDQYVAYT**************************QSSSWEDMSSLVYSTMVSDYETCQQSVPQDSTSFEDERYFG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGKQRKEQQARRGNSCLKQEMIKREIDQTTSVVPAVAGIDIMMNNQTPYWPELPFVTPPLVSSQQDQSSLKDLLIKLGGRFCDGDHHQQSITAACPFDASLAQSQDDQLLYDSNTMSLLSIASPTSMNISSTQLPNTQYNVIGAAPNMSQGLANFPxxxxxxxxxxxxxxxxxxxxxERLYVSGSTTGNSTSADQSSSWEDMSSLVYSTMVSDYETCQQSVPQDSTSFEDERYFGHQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query354 2.2.26 [Sep-21-2011]
Q9M2Y9310 Transcription factor RAX3 yes no 0.816 0.932 0.529 3e-76
Q9SJL7298 Transcription factor RAX2 no no 0.336 0.399 0.848 2e-59
Q9FG68329 Transcription factor RAX1 no no 0.333 0.358 0.805 7e-56
Q7XBH4257 Myb-related protein Myb4 no no 0.327 0.451 0.658 2e-42
P81392316 Myb-related protein 306 O N/A no 0.347 0.389 0.629 1e-41
Q9SZP1282 Transcription repressor M no no 0.336 0.421 0.591 1e-40
P81393232 Myb-related protein 308 O N/A no 0.336 0.512 0.6 2e-40
Q9S9K9257 Transcription factor MYB3 no no 0.336 0.463 0.6 2e-40
Q8GWP0360 Transcription factor MYB3 no no 0.330 0.325 0.630 2e-40
P80073421 Myb-related protein Pp2 O N/A no 0.327 0.275 0.623 3e-40
>sp|Q9M2Y9|RAX3_ARATH Transcription factor RAX3 OS=Arabidopsis thaliana GN=RAX3 PE=2 SV=1 Back     alignment and function desciption
 Score =  285 bits (729), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 180/340 (52%), Positives = 212/340 (62%), Gaps = 51/340 (15%)

Query: 1   MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLN 60
           MGRAPCCDKANVKKGPWSPEEDAKLK+YIE  GTGGNWIALP KIGLKRCGKSCRLRWLN
Sbjct: 1   MGRAPCCDKANVKKGPWSPEEDAKLKSYIENSGTGGNWIALPQKIGLKRCGKSCRLRWLN 60

Query: 61  YLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGK 120
           YLRPNIKHGGFSEEE+NIICSLY++IGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKL+ K
Sbjct: 61  YLRPNIKHGGFSEEEENIICSLYLTIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLINK 120

Query: 121 QRKEQQARRGNSCLKQEMIKREIDQTTSVVPAVAGIDIMMNNQTPY-WP------ELPFV 173
           QRKE Q           M+KR+  Q            +M  +QT + WP      ++P +
Sbjct: 121 QRKELQEACMEQQEMMVMMKRQHQQQQIQTSF-----MMRQDQTMFTWPLHHHNVQVPAL 175

Query: 174 TPPLVSSQQDQSSLKDLLIKLGGRFCDGD-------HHQQSITAACPFDASLAQSQDDQL 226
                +S  DQ  +K +LIK   +  D +       HHQ S+T A  FD  L+ S   QL
Sbjct: 176 FMNQTNSFCDQEDVKPVLIKNMVKIEDQELEKTNPHHHQDSMTNA--FD-HLSFS---QL 229

Query: 227 LYDSNTMSLLSIASPTSMNISSTQLPNTQYNVIGAAPNMSQGLANFPFEQLNDQYVAYTN 286
           L D N   L    S    +++S    NT   ++  + N +Q   NF  E +N        
Sbjct: 230 LLDPNHNHL---GSGEGFSMNSILSANTNSPLLNTS-NDNQWFGNFQAETVN-------- 277

Query: 287 NHQQLEELERLYVSGSTTGNSTSADQSS-SWEDMSSLVYS 325
                        SG++T  STSADQS+ SWED+SSLVYS
Sbjct: 278 -----------LFSGAST--STSADQSTISWEDISSLVYS 304
Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SJL7|RAX2_ARATH Transcription factor RAX2 OS=Arabidopsis thaliana GN=RAX2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FG68|RAX1_ARATH Transcription factor RAX1 OS=Arabidopsis thaliana GN=RAX1 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|P81392|MYB06_ANTMA Myb-related protein 306 OS=Antirrhinum majus GN=MYB306 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function description
>sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
224095011343 predicted protein [Populus trichocarpa] 0.915 0.944 0.604 1e-104
296090689339 unnamed protein product [Vitis vinifera] 0.929 0.970 0.590 1e-101
302142145340 unnamed protein product [Vitis vinifera] 0.923 0.961 0.557 2e-98
385843181346 R2R3-MYB transcription factor MYB1.1 [Qu 0.943 0.965 0.547 1e-95
385845761346 R2R3-MYB transcription factor MYB1.2 [Qu 0.943 0.965 0.544 2e-95
255579515334 r2r3-myb transcription factor, putative 0.889 0.943 0.549 5e-91
147787344330 hypothetical protein VITISV_022764 [Viti 0.895 0.960 0.532 3e-90
357482493309 Myb transcription factor-like protein [M 0.847 0.970 0.551 6e-87
356495518347 PREDICTED: transcription factor RAX3-lik 0.912 0.930 0.542 2e-84
359497543316 PREDICTED: transcription factor RAX3 [Vi 0.864 0.968 0.532 4e-83
>gi|224095011|ref|XP_002310327.1| predicted protein [Populus trichocarpa] gi|222853230|gb|EEE90777.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 223/369 (60%), Positives = 259/369 (70%), Gaps = 45/369 (12%)

Query: 1   MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLN 60
           MGRAPCCDKANVKKGPWSPEEDA LKAYIEQHGTGGNWIALP KIGLKRCGKSCRLRWLN
Sbjct: 1   MGRAPCCDKANVKKGPWSPEEDAILKAYIEQHGTGGNWIALPQKIGLKRCGKSCRLRWLN 60

Query: 61  YLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGK 120
           YLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGK
Sbjct: 61  YLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGK 120

Query: 121 QRKEQQARRGNSCLKQE-MIKREIDQTTSVVPAVAGIDIMMNNQTPYWPELPFVTPPLVS 179
           QRKEQ ARR +  LKQE M KREI+++  V  A+       + Q+PYWPE+    P LV 
Sbjct: 121 QRKEQAARRAS--LKQEIMTKREINESFMVPGAIP------HQQSPYWPEV----PALVM 168

Query: 180 SQQ------DQSSLKDLLIKLGGRFCDGDHHQQSITAA--CPFDASLAQSQDDQLLYDSN 231
           +Q       DQ S+++LLIKLGGRF D +      T     P D S   S+ DQ+ Y +N
Sbjct: 169 NQNQDSHLMDQESIRNLLIKLGGRFSDNNQESALFTTINNYPLDGS---SRQDQVPY-TN 224

Query: 232 TMSLLSIASPT-SMNIS-STQLPNTQYNVIGAAPNMSQ-GLANFPFEQLNDQYVAYTNNH 288
           ++ +LS ++P  SM+ +  +Q PN+ YN     PNM Q GL N   E          +N 
Sbjct: 225 SIDVLSSSAPMRSMDSTCCSQFPNSNYN----GPNMCQAGLENLLVELGG----LVCSNP 276

Query: 289 QQLEELERLY-----VSGSTTGNSTSADQSSSWEDMSSLVYSTMVSDYETCQQSVPQDST 343
           Q++E L+  Y      SGST     S+ +S+SW  +SSL Y  +VSDYETC QS+PQDS 
Sbjct: 277 QRVEGLDSFYGMDMAASGST---GASSAESNSWGHISSLGYPQLVSDYETCLQSMPQDS- 332

Query: 344 SFEDERYFG 352
           SFED  +FG
Sbjct: 333 SFEDSSFFG 341

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296090689|emb|CBI41089.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142145|emb|CBI19348.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|385843181|gb|AFI80887.1| R2R3-MYB transcription factor MYB1.1 [Quercus suber] gi|385843182|gb|AFI80888.1| R2R3-MYB transcription factor MYB1.2 [Quercus suber] gi|385845759|gb|AFI81248.1| R2R3-MYB transcription factor MYB1.1 [Quercus suber] Back     alignment and taxonomy information
>gi|385845761|gb|AFI81249.1| R2R3-MYB transcription factor MYB1.2 [Quercus suber] Back     alignment and taxonomy information
>gi|255579515|ref|XP_002530600.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223529848|gb|EEF31780.1| r2r3-myb transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147787344|emb|CAN62567.1| hypothetical protein VITISV_022764 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357482493|ref|XP_003611533.1| Myb transcription factor-like protein [Medicago truncatula] gi|355512868|gb|AES94491.1| Myb transcription factor-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356495518|ref|XP_003516624.1| PREDICTED: transcription factor RAX3-like [Glycine max] Back     alignment and taxonomy information
>gi|359497543|ref|XP_002266801.2| PREDICTED: transcription factor RAX3 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
TAIR|locus:2169970374 MYB68 "myb domain protein 68" 0.483 0.457 0.672 1.4e-72
TAIR|locus:2174557333 MYB36 "myb domain protein 36" 0.316 0.336 0.919 5.4e-59
TAIR|locus:2097335310 MYB84 "myb domain protein 84" 0.731 0.835 0.503 9.3e-59
TAIR|locus:2057931298 RAX2 "REGULATOR OF AXILLARY ME 0.316 0.375 0.857 7.8e-56
TAIR|locus:2137589305 MYB87 "myb domain protein 87" 0.316 0.367 0.848 3e-53
TAIR|locus:2181146329 MYB37 "myb domain protein 37" 0.460 0.495 0.595 6.9e-53
TAIR|locus:2146804352 MYB86 "myb domain protein 86" 0.310 0.312 0.585 5.7e-44
TAIR|locus:2154119352 MYB96 "myb domain protein 96" 0.310 0.312 0.621 1e-42
TAIR|locus:2161820320 MYB80 [Arabidopsis thaliana (t 0.313 0.346 0.669 1.7e-41
TAIR|locus:2102152388 MYB106 "myb domain protein 106 0.302 0.275 0.657 1.1e-40
TAIR|locus:2169970 MYB68 "myb domain protein 68" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 620 (223.3 bits), Expect = 1.4e-72, Sum P(2) = 1.4e-72
 Identities = 121/180 (67%), Positives = 133/180 (73%)

Query:     1 MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLN 60
             MGRAPCCDKANVKKGPWSPEEDAKLK YIE  GTGGNWIALP KIGL+RCGKSCRLRWLN
Sbjct:     1 MGRAPCCDKANVKKGPWSPEEDAKLKDYIENSGTGGNWIALPQKIGLRRCGKSCRLRWLN 60

Query:    61 YLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRXXXXXXXX 120
             YLRPNIKHGGFSEEEDNIIC+LY++IGSRWSIIAAQLPGRTDNDIKNYWNTR        
Sbjct:    61 YLRPNIKHGGFSEEEDNIICNLYVTIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLNK 120

Query:   121 XXXXXXARRGNSCLKQEMI--KREIDQTTSVVPAVAGIDIMMNNQ--TPYWPELPFVTPP 176
                     R    +KQEM+  KR+  Q      +    D+ +NN   +  WP LP + PP
Sbjct:   121 QRKEFQEAR----MKQEMVMMKRQ-QQGQGQGQSNGSTDLYLNNMFGSSPWPLLPQLPPP 175
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0000041 "transition metal ion transport" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2174557 MYB36 "myb domain protein 36" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097335 MYB84 "myb domain protein 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057931 RAX2 "REGULATOR OF AXILLARY MERISTEMS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137589 MYB87 "myb domain protein 87" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181146 MYB37 "myb domain protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146804 MYB86 "myb domain protein 86" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154119 MYB96 "myb domain protein 96" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161820 MYB80 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102152 MYB106 "myb domain protein 106" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2Y9RAX3_ARATHNo assigned EC number0.52940.81630.9322yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 3e-46
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 2e-44
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-14
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 2e-13
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-11
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 1e-10
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 5e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 6e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 4e-04
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  163 bits (413), Expect = 3e-46
 Identities = 73/122 (59%), Positives = 95/122 (77%), Gaps = 3/122 (2%)

Query: 1   MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLN 60
           MGR  CC K  ++KG WSPEED KL  +I ++G G  W ++P + GL+RCGKSCRLRW+N
Sbjct: 1   MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGC-WSSVPKQAGLQRCGKSCRLRWIN 59

Query: 61  YLRPNIKHGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGK 120
           YLRP++K G FS++E+N+I  L+  +G+RWS IAAQLPGRTDN+IKN WN+ LKKKL  +
Sbjct: 60  YLRPDLKRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKL--R 117

Query: 121 QR 122
           QR
Sbjct: 118 QR 119

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 354
PLN03091 459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.71
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.64
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.6
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.52
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.4
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.39
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.36
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.31
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.28
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.2
PLN03212249 Transcription repressor MYB5; Provisional 99.19
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.07
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.07
PLN03091 459 hypothetical protein; Provisional 98.99
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.9
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.76
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.66
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.31
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.54
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.35
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.24
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.23
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.15
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.08
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.05
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.0
KOG1279506 consensus Chromatin remodeling factor subunit and 96.63
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.55
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.55
PRK13923170 putative spore coat protein regulator protein YlbO 96.48
KOG1279506 consensus Chromatin remodeling factor subunit and 95.8
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 95.78
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.45
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.34
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.32
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 94.89
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 93.97
PLN031421033 Probable chromatin-remodeling complex ATPase chain 92.81
KOG4282345 consensus Transcription factor GT-2 and related pr 92.67
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 92.54
PRK13923170 putative spore coat protein regulator protein YlbO 92.52
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 92.46
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 91.44
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 90.85
KOG2656445 consensus DNA methyltransferase 1-associated prote 90.82
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 89.3
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 86.13
KOG4167907 consensus Predicted DNA-binding protein, contains 84.58
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.9e-37  Score=306.38  Aligned_cols=117  Identities=61%  Similarity=1.145  Sum_probs=114.2

Q ss_pred             CCCCccCCCCCCCCCCCCHHHHHHHHHHHHHhCCCCCcceecccccccccCccccccccccccCCCCCCCCChHHHHHHH
Q 036344            1 MGRAPCCDKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIIC   80 (354)
Q Consensus         1 Mgr~pc~~Kp~lkKG~WT~EEDe~L~~lV~k~G~~~nW~~IAk~lg~~Rt~kQCReRW~n~L~P~lkkg~WTeEED~~Ll   80 (354)
                      |||++||+|.+++||+||+|||++|+++|.+||. .+|..||+.++++|+++|||+||.+||+|.+++++||.|||++|+
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~-~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLL   79 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGH-GCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLII   79 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCc-CCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHH
Confidence            9999999999999999999999999999999998 799999999887999999999999999999999999999999999


Q ss_pred             HHHHHhCCCHHHHHhhCCCCCHHHHHHHHHHHhhhhhh
Q 036344           81 SLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLL  118 (354)
Q Consensus        81 elv~~~G~kWs~IAk~LpGRT~nqcKnRW~slLrkk~~  118 (354)
                      +++++||++|+.||++|+|||+++|||||+.+++++++
T Consensus        80 eL~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr  117 (459)
T PLN03091         80 ELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLR  117 (459)
T ss_pred             HHHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999998765

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 4e-20
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-19
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 3e-19
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 5e-19
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 1e-18
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 5e-16
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 3e-15
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 4e-10
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 8e-08
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 2e-07
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 1e-04
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 3e-04
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 4e-04
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 95.5 bits (236), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/98 (45%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
Query: 14  KGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSE 73
           KGPW+ EED K+   ++++GT    +   H  G  R GK CR RW N+L P +K   ++E
Sbjct: 7   KGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKG--RLGKQCRERWHNHLNPEVKKSSWTE 64
Query: 74  EEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNT 111
           EED II   +  +G+RW+ IA  LPGRTDN +KN+WN+
Sbjct: 65  EEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNS 102
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-61
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 5e-61
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 6e-61
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 6e-61
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-53
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 3e-53
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-25
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 5e-25
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 9e-20
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-16
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 4e-10
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 1e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 4e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 8e-07
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 8e-07
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-06
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 3e-05
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 4e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-04
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 1e-04
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 3e-04
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 3e-04
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
 Score =  191 bits (488), Expect = 2e-61
 Identities = 43/117 (36%), Positives = 60/117 (51%), Gaps = 3/117 (2%)

Query: 8   DKANVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIK 67
           +    KK  ++PEED  LK  + QHG+    IA        R  + CR RW NYL P+I 
Sbjct: 5   NLKAAKKQKFTPEEDEMLKRAVAQHGSDWKMIA---ATFPNRNARQCRDRWKNYLAPSIS 61

Query: 68  HGGFSEEEDNIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLLGKQRKE 124
           H  ++ EED ++       G +W+IIA   PGRTD  IKN W T   K  + + ++ 
Sbjct: 62  HTPWTAEEDALLVQKIQEYGRQWAIIAKFFPGRTDIHIKNRWVTISNKLGIPQTQQM 118
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.98
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.98
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.98
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.84
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.83
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.75
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.74
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.67
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.65
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.65
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.64
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.64
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.64
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.62
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.61
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.6
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.6
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.58
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.58
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.57
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.56
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.55
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.53
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.52
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.51
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.5
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.49
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.22
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.48
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.46
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.45
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.44
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.39
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.38
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.36
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.34
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.33
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.33
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.32
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.31
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.3
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.29
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.29
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.26
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.25
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.24
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.89
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.24
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.17
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.17
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.17
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.97
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.95
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.81
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.78
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.69
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.59
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.5
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.42
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.41
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.32
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.29
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.21
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.04
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.02
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.01
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.94
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.06
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.79
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.73
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.66
2crg_A70 Metastasis associated protein MTA3; transcription 97.56
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.54
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.51
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.33
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.11
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.01
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.0
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.36
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.34
2crg_A70 Metastasis associated protein MTA3; transcription 96.31
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.22
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.19
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.05
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.83
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 93.26
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 93.2
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 92.17
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.0
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=4.7e-34  Score=234.26  Aligned_cols=105  Identities=42%  Similarity=0.852  Sum_probs=99.4

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCCcceecccccccccCccccccccccccCCCCCCCCChHHHHHHHHHHHHhCCCH
Q 036344           11 NVKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISIGSRW   90 (354)
Q Consensus        11 ~lkKG~WT~EEDe~L~~lV~k~G~~~nW~~IAk~lg~~Rt~kQCReRW~n~L~P~lkkg~WTeEED~~Llelv~~~G~kW   90 (354)
                      .+++|+||+|||++|+++|.+||. .+|..||+.|+ +|+++||++||.++|+|.+++++||+|||.+|++++.+||++|
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~-~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W   78 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGP-KRWSVIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRW   78 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCT-TCHHHHHTTST-TCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCC-CcHHHHhhhhc-CCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCH
Confidence            478999999999999999999997 68999999998 9999999999999999999999999999999999999999999


Q ss_pred             HHHHhhCCCCCHHHHHHHHHHHhhhhh
Q 036344           91 SIIAAQLPGRTDNDIKNYWNTRLKKKL  117 (354)
Q Consensus        91 s~IAk~LpGRT~nqcKnRW~slLrkk~  117 (354)
                      +.||++|||||+++||+||+.++++++
T Consensus        79 ~~Ia~~l~gRt~~~~k~rw~~~~~~~~  105 (105)
T 1gv2_A           79 AEIAKLLPGRTDNAIKNHWNSTMRRKV  105 (105)
T ss_dssp             HHHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHHhccC
Confidence            999999999999999999999998763
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 354
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-18
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-09
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-18
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-08
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 5e-17
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 2e-10
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-14
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-06
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-14
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-05
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-12
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 6e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-10
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 9e-13
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-08
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 5e-11
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-05
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 6e-07
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 4e-09
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 9e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 5e-06
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 8e-06
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 75.1 bits (185), Expect = 3e-18
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 12 VKKGPWSPEEDAKLKAYIEQHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRP 64
          + KGPW+ EED +L   ++++G    W  +   +   R GK CR RW N+L P
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGP-KRWSVIAKHLK-GRIGKQCRERWHNHLNP 51
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.71
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.67
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.61
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.53
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.51
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.46
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.46
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.44
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.42
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.4
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.39
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.37
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.33
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.32
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.31
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.27
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.23
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.23
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.22
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.2
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.12
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.1
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.09
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.79
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.77
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.61
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.09
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.93
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.39
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.29
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.29
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.12
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.39
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.3
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 93.26
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 92.58
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 90.61
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 87.58
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 84.01
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 82.18
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.71  E-value=2.7e-20  Score=148.09  Aligned_cols=72  Identities=17%  Similarity=0.195  Sum_probs=65.5

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCC----CCcceecccccccccCccccccccccccCCCCCCCCChHHHHHHHHHHHHh
Q 036344           14 KGPWSPEEDAKLKAYIEQHGTG----GNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDNIICSLYISI   86 (354)
Q Consensus        14 KG~WT~EEDe~L~~lV~k~G~~----~nW~~IAk~lg~~Rt~kQCReRW~n~L~P~lkkg~WTeEED~~Llelv~~~   86 (354)
                      |++||+|||++|+++|.+||..    .+|..||+.|+ +||++|||+||.++|+|.+++++||.+||.+|+..+..+
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~l   76 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNL   76 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCB
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhcc
Confidence            6899999999999999999961    24999999998 999999999999999999999999999999988766443
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure