Citrus Sinensis ID: 036362

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MEKYRKVELIGRGKYGSFYKCEEDVAENAYQTVLLKADIIPDGVPISILTKISPLKEMDYPLIFRKENDKLVYQIFEYTGLLNLRKVIKNFLDIINNPKTAKILRVLSYYHSNRCLHGRLNPYQALINLSDYTVKIARLISVGCIFAEMVIQEPLSEDASESRERISIFRLMGEPSEETLPGVTTFFPFIYCYEESEPKDLAILLPDLEPAGVDLLQKMLRVNPKERITVNDALNHHYYRDVVSVP
cccEEEEccccccccEEEEEEECcccccEEEEEEEccccccccccHHHHHHHHHHHcccccccEEEccccEEEEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccHHHccccccHHHHHHHHHcccccccccccHHHHccccccccccccc
MEKYRKVELIGRGKYGSFYKCEEDVAENAYQTVLLKADIIPDGVPISILTKISPLKEMDYPLIFRKENDKLVYQIFEYTGLLNLRKVIKNFLDIINNPKTAKILRVLSYYHSNRCLHGRLNPYQALINLSDYTVKIARLISVGCIFAEMVIQEPLSEDASESRERISIFRLMGEPSEETLPGVTTFFPFIYCYEESEPKDLAILLPDLEPAGVDLLQKMLRVNPKERITVNDALNHHYYRDVVSV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKYRKVELIGRGKYGSFYKCEEDVAENAYQTVLLKADIIPDGVPISILTKISPLKEMDYPLIFRKENDKLVYQIFEYTGLLNLRKVIKNFLDIINNPKTAKILRVLSYYHSNRCLHGRLNPYQALINLSDYTVKIARLISVGCIFAEMVIQEPLSEDASESRERISIFRLMGEPSEETLPGVTTFFPFIYCYEESEPKDLAILLPDLEPAGVDLLQKMLRVNPKERITVNDALNHHYYRDVVSVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-dependent kinase A-1 Involved in the control of the cell cycle. Essential for both G1/S and G2/M (mitosis) phase transitions. Functions in cell morphogenesis as well as cell proliferation. Required for cell division (entry into mitosis) of the generative cell in male gametogenesis.probableP24100
Cell division control protein 2 homolog Plays a key role in the control of the eukaryotic cell cycle. It is required in higher cells for entry into S-phase and mitosis. Component of the kinase complex that phosphorylates the repetitive C-terminus of RNA polymerase II.probableO96821
Cyclin-dependent kinase A-1 probableP29618

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RP9, chain A
Confidence level:very confident
Coverage over the Query: 2-243
View the alignment between query and template
View the model in PyMOL