Citrus Sinensis ID: 036366

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MALRSLAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV
ccHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccc
*****LAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRSLAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Superoxide dismutase [Mn] 1, mitochondrial Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.probableO81235
Superoxide dismutase [Fe] Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.probableO93724

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IDS, chain A
Confidence level:very confident
Coverage over the Query: 26-83
View the alignment between query and template
View the model in PyMOL