Citrus Sinensis ID: 036366

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MALRSLAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV
ccHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccc
cHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHcccHHHHccccHHHHH
MALRSLAIRKAIGlgksvglglrglqtvtlpdlpydysalepaisGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNkvdtstvv
MALRSLAIRKAIglgksvglglrGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQAlnkvdtstvv
MALRSLAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV
*****LAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALN********
************************LQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV
MALRSLAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV
***RSLAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRSLAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
O81235 231 Superoxide dismutase [Mn] yes no 1.0 0.363 0.701 8e-28
P35017 233 Superoxide dismutase [Mn] N/A no 1.0 0.360 0.689 3e-27
P11796 228 Superoxide dismutase [Mn] N/A no 0.988 0.364 0.662 6e-26
Q9SM64 228 Superoxide dismutase [Mn] N/A no 0.988 0.364 0.650 2e-25
O49066 228 Superoxide dismutase [Mn] N/A no 0.988 0.364 0.614 8e-23
P27084 233 Superoxide dismutase [Mn] N/A no 1.0 0.360 0.562 1e-22
P09233 235 Superoxide dismutase [Mn] N/A no 1.0 0.357 0.593 2e-22
Q43008 231 Superoxide dismutase [Mn] yes no 1.0 0.363 0.597 2e-21
P41980 233 Superoxide dismutase [Mn] N/A no 1.0 0.360 0.584 3e-20
P41979 233 Superoxide dismutase [Mn] N/A no 1.0 0.360 0.539 2e-19
>sp|O81235|SODM1_ARATH Superoxide dismutase [Mn] 1, mitochondrial OS=Arabidopsis thaliana GN=MSD1 PE=1 SV=2 Back     alignment and function desciption
 Score =  122 bits (305), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 71/87 (81%), Gaps = 3/87 (3%)

Query: 1  MALRSLAIRKAI-GLGKSVG--LGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHH 57
          MA+R +A RK + GL ++    L +RG+QT TLPDLPYDY ALEPAISGEIMQ+HHQKHH
Sbjct: 1  MAIRCVASRKTLAGLKETSSRLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHH 60

Query: 58 QAYVTNYNKAVEQLFQALNKVDTSTVV 84
          QAYVTNYN A+EQL QA+NK D STVV
Sbjct: 61 QAYVTNYNNALEQLDQAVNKGDASTVV 87
Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|P35017|SODM_HEVBR Superoxide dismutase [Mn], mitochondrial OS=Hevea brasiliensis GN=SODA PE=2 SV=1 Back     alignment and function description
>sp|P11796|SODM_NICPL Superoxide dismutase [Mn], mitochondrial OS=Nicotiana plumbaginifolia GN=SODA PE=1 SV=1 Back     alignment and function description
>sp|Q9SM64|SODM_PRUPE Superoxide dismutase [Mn], mitochondrial OS=Prunus persica GN=SOD PE=2 SV=1 Back     alignment and function description
>sp|O49066|SODM_CAPAN Superoxide dismutase [Mn], mitochondrial OS=Capsicum annuum GN=SODA PE=2 SV=1 Back     alignment and function description
>sp|P27084|SODM_PEA Superoxide dismutase [Mn], mitochondrial OS=Pisum sativum GN=SODA PE=2 SV=2 Back     alignment and function description
>sp|P09233|SODM1_MAIZE Superoxide dismutase [Mn] 3.1, mitochondrial OS=Zea mays GN=SODA.4 PE=2 SV=1 Back     alignment and function description
>sp|Q43008|SODM_ORYSJ Superoxide dismutase [Mn], mitochondrial OS=Oryza sativa subsp. japonica GN=SODA PE=2 SV=2 Back     alignment and function description
>sp|P41980|SODM4_MAIZE Superoxide dismutase [Mn] 3.4, mitochondrial OS=Zea mays GN=SODA.3 PE=2 SV=1 Back     alignment and function description
>sp|P41979|SODM3_MAIZE Superoxide dismutase [Mn] 3.3, mitochondrial OS=Zea mays GN=SODA.2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
283101130 228 manganese superoxide dismutase [Citrus j 1.0 0.368 0.964 1e-39
381141814 228 Mn/Fe superoxide dismutase [Tetradium ru 1.0 0.368 0.940 1e-39
225448693 228 PREDICTED: superoxide dismutase [Mn], mi 1.0 0.368 0.726 4e-29
429843334 221 manganese superoxide dismutase, partial 1.0 0.380 0.752 7e-29
339777235 221 manganese superoxide dismutase [Litchi c 1.0 0.380 0.741 1e-28
161778782 228 manganese superoxide dismutase [Vitis vi 1.0 0.368 0.714 1e-28
212664085 221 mitochondrial manganese superoxide dismu 1.0 0.380 0.752 4e-28
148515008 231 Mn superoxide dismutase [Eutrema halophi 1.0 0.363 0.735 6e-28
119514376 231 putative Mn superoxide dismutase [Eutrem 1.0 0.363 0.735 6e-28
169244541 231 putative manganese superoxide dismutase 1.0 0.363 0.735 1e-27
>gi|283101130|gb|ADB10839.1| manganese superoxide dismutase [Citrus japonica] Back     alignment and taxonomy information
 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (97%)

Query: 1  MALRSLAIRKAIGLGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAY 60
          MALRSLA RKAIG+GKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAY
Sbjct: 1  MALRSLATRKAIGMGKSVGLGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAY 60

Query: 61 VTNYNKAVEQLFQALNKVDTSTVV 84
          VTNYNKAVEQL QALNKVDTSTVV
Sbjct: 61 VTNYNKAVEQLGQALNKVDTSTVV 84

Source: Citrus japonica

Species: Citrus japonica

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|381141814|gb|AFF57843.1| Mn/Fe superoxide dismutase [Tetradium ruticarpum] Back     alignment and taxonomy information
>gi|225448693|ref|XP_002280527.1| PREDICTED: superoxide dismutase [Mn], mitochondrial [Vitis vinifera] gi|147839972|emb|CAN61687.1| hypothetical protein VITISV_024204 [Vitis vinifera] Back     alignment and taxonomy information
>gi|429843334|gb|AGA16522.1| manganese superoxide dismutase, partial [Litchi chinensis] Back     alignment and taxonomy information
>gi|339777235|gb|AEK05514.1| manganese superoxide dismutase [Litchi chinensis] Back     alignment and taxonomy information
>gi|161778782|gb|ABX79342.1| manganese superoxide dismutase [Vitis vinifera] Back     alignment and taxonomy information
>gi|212664085|gb|ACB54690.2| mitochondrial manganese superoxide dismutase [Dimocarpus longan] gi|222447180|gb|ACM17484.2| manganese superoxide dismutase [Dimocarpus longan] gi|345019000|gb|ADK70384.2| mitochondrial manganese superoxide dismutase [Dimocarpus longan] Back     alignment and taxonomy information
>gi|148515008|gb|ABQ81865.1| Mn superoxide dismutase [Eutrema halophilum] Back     alignment and taxonomy information
>gi|119514376|gb|ABL75952.1| putative Mn superoxide dismutase [Eutrema halophilum] Back     alignment and taxonomy information
>gi|169244541|gb|ACA50527.1| putative manganese superoxide dismutase 1 [Brassica napus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
TAIR|locus:2085552 231 MSD1 "manganese superoxide dis 1.0 0.363 0.701 1.5e-26
UNIPROTKB|P11796 228 SODA "Superoxide dismutase [Mn 0.988 0.364 0.662 5.9e-25
UNIPROTKB|Q9SM64 228 SOD "Superoxide dismutase [Mn] 0.988 0.364 0.650 2e-24
TAIR|locus:2078356 241 AT3G56350 [Arabidopsis thalian 0.75 0.261 0.634 1.1e-16
FB|FBgn0010213 217 Sod2 "Superoxide dismutase 2 ( 0.738 0.285 0.609 1.3e-15
DICTYBASE|DDB_G0271106 226 sod2 "putative mitochondrial s 0.976 0.362 0.5 6.9e-15
ASPGD|ASPL0000032078 223 sodB [Emericella nidulans (tax 0.547 0.206 0.717 1.8e-14
MGI|MGI:98352 222 Sod2 "superoxide dismutase 2, 0.904 0.342 0.506 3e-14
UNIPROTKB|F1SB60 222 SOD2 "Superoxide dismutase [Mn 0.773 0.292 0.575 3.8e-14
UNIPROTKB|K7GQ61162 SOD2 "Superoxide dismutase" [S 0.773 0.401 0.575 3.8e-14
TAIR|locus:2085552 MSD1 "manganese superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 299 (110.3 bits), Expect = 1.5e-26, P = 1.5e-26
 Identities = 61/87 (70%), Positives = 71/87 (81%)

Query:     1 MALRSLAIRKAI-GLGKSVG--LGLRGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHH 57
             MA+R +A RK + GL ++    L +RG+QT TLPDLPYDY ALEPAISGEIMQ+HHQKHH
Sbjct:     1 MAIRCVASRKTLAGLKETSSRLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHH 60

Query:    58 QAYVTNYNKAVEQLFQALNKVDTSTVV 84
             QAYVTNYN A+EQL QA+NK D STVV
Sbjct:    61 QAYVTNYNNALEQLDQAVNKGDASTVV 87
GO:0004784 "superoxide dismutase activity" evidence=IEA;IDA
GO:0005739 "mitochondrion" evidence=ISM;NAS;IDA
GO:0006801 "superoxide metabolic process" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;IDA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0010043 "response to zinc ion" evidence=IEP
GO:0005507 "copper ion binding" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009060 "aerobic respiration" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
GO:0019430 "removal of superoxide radicals" evidence=IC
UNIPROTKB|P11796 SODA "Superoxide dismutase [Mn], mitochondrial" [Nicotiana plumbaginifolia (taxid:4092)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SM64 SOD "Superoxide dismutase [Mn], mitochondrial" [Prunus persica (taxid:3760)] Back     alignment and assigned GO terms
TAIR|locus:2078356 AT3G56350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0010213 Sod2 "Superoxide dismutase 2 (Mn)" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271106 sod2 "putative mitochondrial superoxide dismutase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000032078 sodB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
MGI|MGI:98352 Sod2 "superoxide dismutase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SB60 SOD2 "Superoxide dismutase [Mn], mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GQ61 SOD2 "Superoxide dismutase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O93724SODF_PYRAE1, ., 1, 5, ., 1, ., 10.72090.51190.2037yesno
O81235SODM1_ARATH1, ., 1, 5, ., 1, ., 10.70111.00.3636yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.1LOW CONFIDENCE prediction!
3rd Layer1.15.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
PLN02471 231 PLN02471, PLN02471, superoxide dismutase [Mn] 3e-44
pfam0008182 pfam00081, Sod_Fe_N, Iron/manganese superoxide dis 1e-25
COG0605 204 COG0605, SodA, Superoxide dismutase [Inorganic ion 1e-22
PRK10925 206 PRK10925, PRK10925, superoxide dismutase; Provisio 3e-14
PRK10543 193 PRK10543, PRK10543, superoxide dismutase; Provisio 4e-11
PTZ00078 193 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Pro 5e-08
PLN02685 299 PLN02685, PLN02685, iron superoxide dismutase 3e-07
PLN02622 261 PLN02622, PLN02622, iron superoxide dismutase 3e-06
PLN02184 212 PLN02184, PLN02184, superoxide dismutase [Fe] 2e-05
>gnl|CDD|215262 PLN02471, PLN02471, superoxide dismutase [Mn] Back     alignment and domain information 
 Score =  141 bits (358), Expect = 3e-44
 Identities = 63/87 (72%), Positives = 67/87 (77%), Gaps = 3/87 (3%)

Query: 1  MALRSLAIRKAIGLGKSVGLGL---RGLQTVTLPDLPYDYSALEPAISGEIMQLHHQKHH 57
          MALR+LA RK +G  K     L   RGLQT TLPDLPYDY ALEPAISGEIMQLHHQKHH
Sbjct: 1  MALRTLASRKTLGGLKETSSRLLSFRGLQTFTLPDLPYDYGALEPAISGEIMQLHHQKHH 60

Query: 58 QAYVTNYNKAVEQLFQALNKVDTSTVV 84
          Q YVTNYNKA+EQL QA+ K D S VV
Sbjct: 61 QTYVTNYNKALEQLDQAVEKGDASAVV 87

Length = 231
>gnl|CDD|200985 pfam00081, Sod_Fe_N, Iron/manganese superoxide dismutases, alpha-hairpin domain Back     alignment and domain information
>gnl|CDD|223678 COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182843 PRK10925, PRK10925, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|182534 PRK10543, PRK10543, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|185432 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>gnl|CDD|215369 PLN02685, PLN02685, iron superoxide dismutase Back     alignment and domain information
>gnl|CDD|166263 PLN02622, PLN02622, iron superoxide dismutase Back     alignment and domain information
>gnl|CDD|177838 PLN02184, PLN02184, superoxide dismutase [Fe] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
PF0008182 Sod_Fe_N: Iron/manganese superoxide dismutases, al 99.91
PLN02471 231 superoxide dismutase [Mn] 99.9
COG0605 204 SodA Superoxide dismutase [Inorganic ion transport 99.86
PRK10925 206 superoxide dismutase; Provisional 99.84
PLN02184 212 superoxide dismutase [Fe] 99.82
PRK10543 193 superoxide dismutase; Provisional 99.8
PLN02685 299 iron superoxide dismutase 99.78
PLN02622 261 iron superoxide dismutase 99.75
PTZ00078 193 Superoxide dismutase [Fe]; Provisional 99.74
KOG0876 234 consensus Manganese superoxide dismutase [Inorgani 99.73
>PF00081 Sod_Fe_N: Iron/manganese superoxide dismutases, alpha-hairpin domain Note: SCOP classifies the two domains separately Back     alignment and domain information 
Probab=99.91  E-value=3.6e-25  Score=142.00  Aligned_cols=47  Identities=60%  Similarity=0.911  Sum_probs=38.5

Q ss_pred             ceeCCCCCCCcCcccccccHHHHHHHHHhhHHHHHHHHHHHHHHHHH
Q 036366           27 TVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQ   73 (84)
Q Consensus        27 ~f~Lp~LpY~y~aLeP~IS~~tm~~Hy~kHH~~YV~~lN~~~~~~~~   73 (84)
                      .|+||+|||+|+||||+||++||++||+|||++||++||+++++.+.
T Consensus         1 ~f~Lp~LpY~y~aLeP~is~~t~~~H~~kHh~~YV~~lN~~~~~~~~   47 (82)
T PF00081_consen    1 KFELPPLPYAYDALEPYISEETMELHHDKHHQGYVNNLNKALEKTEL   47 (82)
T ss_dssp             SS-----SSSTTTTTTTS-HHHHHHHHHTHHHHHHHHHHHHHTTCHH
T ss_pred             CCCCCCCCCChhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHhcccc
Confidence            48999999999999999999999999999999999999999997643

; InterPro: IPR019831 Superoxide dismutases (SODs) (1.15.1.1 from EC) catalyse the conversion of superoxide radicals to molecular oxygen. Their function is to destroy the radicals that are normally produced within cells and are toxic to biological systems. Three evolutionarily distinct families of SODs are known, of which the Mn/Fe-binding family is one [, , ]. This family includes both single metal-binding SODs and cambialistic SOD, which can bind either Mn or Fe. Fe/MnSODs are ubiquitous enzymes that are responsible for the majority of SOD activity in prokaryotes, fungi, blue-green algae and mitochondria. Fe/MnSODs are found as homodimers or homotetramers. The structure of Fe/MnSODs can be divided into two domains, an alpha N-terminal domain and an alpha/beta C-terminal domain, connected by a loop. The structure of the N-terminal domain consists of a two helices in an antiparallel hairpin, with a left-handed twist []. The structure of the C-terminal domain is of the alpha/beta type, and consists of a three-stranded antiparallel beta-sheet in the order 213, along with four helices in the arrangement alpha/beta(2)/alpha/beta/alpha(2) []. This entry represents the N-terminal domain of Manganese/iron superoxide dismutase. ; GO: 0004784 superoxide dismutase activity, 0046872 metal ion binding, 0006801 superoxide metabolic process, 0055114 oxidation-reduction process; PDB: 3TQJ_A 1MY6_A 1BT8_A 1BSM_B 1AR5_A 1BS3_A 1AR4_A 1AVM_A 3DC6_C 1ZSP_B ....
>PLN02471 superoxide dismutase [Mn] Back     alignment and domain information
>COG0605 SodA Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10925 superoxide dismutase; Provisional Back     alignment and domain information
>PLN02184 superoxide dismutase [Fe] Back     alignment and domain information
>PRK10543 superoxide dismutase; Provisional Back     alignment and domain information
>PLN02685 iron superoxide dismutase Back     alignment and domain information
>PLN02622 iron superoxide dismutase Back     alignment and domain information
>PTZ00078 Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>KOG0876 consensus Manganese superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
1ar4_A 201 X-Ray Structure Analysis Of The Cambialistic Supero 1e-15
3dc6_A 198 Crystal Structure Of A Manganese Superoxide Dismuta 5e-14
3dc5_A 195 Crystal Structure Of A Manganese Superoxide Dismuta 6e-14
3c3s_A 198 Role Of A Glutamate Bridge Spanning The Dimeric Int 3e-13
1pl4_A 198 Crystal Structure Of Human Mnsod Y166f Mutant Lengt 3e-13
2qka_A 196 Structural And Kinetic Study Of The Differences Bet 3e-13
1em1_A 198 X-Ray Crystal Structure For Human Manganese Superox 3e-13
1msd_A 198 Comparison Of The Crystal Structures Of Genetically 3e-13
1qnm_A 198 Human Manganese Superoxide Dismutase Mutant Q143n L 3e-13
1ja8_A 198 Kinetic Analysis Of Product Inhibition In Human Man 3e-13
1n0j_A 199 The Structure Of Human Mitochondrial Mn3+ Superoxid 3e-13
2qkc_A 196 Structural And Kinetic Study Of The Differences Bet 3e-13
3c3t_A 198 Role Of A Glutamate Bridge Spanning The Dimeric Int 3e-13
1var_A 198 Mitochondrial Manganese Superoxide Dismutase Varian 4e-13
1ap5_A 198 Tyr34->phe Mutant Of Human Mitochondrial Manganese 8e-13
1szx_A 198 Role Of Hydrogen Bonding In The Active Site Of Huma 9e-13
3evk_A 222 Crystal Structure Of The Metal-Bound Superoxide Dis 1e-12
1zte_A 198 Contribution To Structure And Catalysis Of Tyrosine 2e-12
1pm9_A 198 Crystal Structure Of Human Mnsod H30n, Y166f Mutant 2e-12
2gds_A 198 Interrupting The Hydrogen Bonding Network At The Ac 2e-12
1luw_A 198 Catalytic And Structural Effects Of Amino-Acid Subs 3e-12
2adp_A 198 Nitrated Human Manganese Superoxide Dismutase Lengt 3e-12
1zuq_A 198 Contribution To Structure And Catalysis Of Tyrosine 3e-12
2p4k_A 198 Contribution To Structure And Catalysis Of Tyrosine 4e-12
1zsp_A 198 Contribution To Structure And Catalysis Of Tyrosine 4e-12
3rn4_A 215 Crystal Structure Of Iron-Substituted Sod2 From Sac 4e-12
3bfr_A 215 The Crystal Structure Of Sod2 From Saccharomyces Ce 5e-12
1gn4_A 207 H145e Mutant Of Mycobacterium Tuberculosis Iron-Sup 5e-12
1gn3_A 207 H145q Mutant Of Mycobacterium Tuberculosis Iron-Sup 6e-12
1gn6_A 207 G152a Mutant Of Mycobacterium Tuberculosis Iron-Sup 6e-12
1gn2_A 207 S123c Mutant Of The Iron-Superoxide Dismutase From 6e-12
1ids_A 207 X-Ray Structure Analysis Of The Iron-Dependent Supe 6e-12
1n0n_A 199 Catalytic And Structural Effects Of Amino-Acid Subs 7e-12
3lsu_A 207 Crystal Structure Of Sod2 From Saccharomyces Cerevi 2e-11
1y67_A 229 Crystal Structure Of Manganese Superoxide Dismutase 3e-11
1xil_A 198 Hydrogen Bonding In Human Manganese Superoxide Dism 3e-11
3kky_A 211 Structure Of Manganese Superoxide Dismutase From De 4e-11
2cdy_A 231 Manganese Superoxide Dismutase (Mn-Sod) From Deinoc 4e-11
1kkc_A 221 Crystal Structure Of Aspergillus Fumigatus Mnsod Le 5e-11
4e4e_A 207 Crystal Structure Of The Y34f Mutant Of Saccharomyc 6e-11
2rcv_A 202 Crystal Structure Of The Bacillus Subtilis Superoxi 1e-10
1xdc_A 198 Hydrogen Bonding In Human Manganese Superoxide Dism 1e-10
1gv3_A 248 The 2.0 Angstrom Resolution Structure Of The Cataly 3e-10
1en6_A 205 Crystal Structure Analysis Of The E. Coli Manganese 4e-10
1i0h_A 205 Crystal Structure Of The E. Coli Manganese Superoxi 4e-10
1vew_A 205 Manganese Superoxide Dismutase From Escherichia Col 5e-10
1en4_A 205 Crystal Structure Analysis Of The E. Coli Manganese 5e-10
3ak1_A 214 Superoxide Dismutase From Aeropyrum Pernix K1, Apo- 5e-10
3mds_A 203 Maganese Superoxide Dismutase From Thermus Thermoph 8e-10
1en5_A 205 Crystal Structure Analysis Of The E. Coli Manganese 1e-09
4ffk_A 223 X-Ray Structure Of Iron Superoxide Dismutase From A 2e-09
1xuq_A 212 Crystal Structure Of Soda-1 (Ba4499) From Bacillus 2e-09
1ma1_A 205 Structure And Properties Of The Atypical Iron Super 5e-09
1i08_A 205 Crystal Structure Analysis Of The H30a Mutant Of Ma 6e-09
3qvn_A 206 Crystal Structure Of Cytosolic Mnsod3 From Candida 6e-09
1jr9_A 202 Crystal Structure Of Manganese Superoxide Dismutase 6e-09
3tqj_A 210 Structure Of The Superoxide Dismutase (Fe) (Sodb) F 1e-08
3tjt_A 208 Crystal Structure Analysis Of The Superoxide Dismut 7e-08
1xre_A 217 Crystal Structure Of Soda-2 (Ba5696) From Bacillus 2e-07
3h1s_A 195 Crystal Structure Of Superoxide Dismutase From Fran 3e-07
1dt0_A 197 Cloning, Sequence, And Crystallographic Structure O 4e-07
3sdp_A 195 The 2.1 Angstroms Resolution Structure Of Iron Supe 8e-07
1isa_A 192 Structure-Function In E. Coli Iron Superoxide Dismu 2e-06
2nyb_A 192 Crystal Structure Of E.Coli Iron Superoxide Dismuta 2e-06
1za5_A 192 Q69h-Fesod Length = 192 2e-06
3lio_A 192 X-Ray Structure Of The Iron Superoxide Dismutase Fr 4e-06
1wb8_A 210 Iron Superoxide Dismutase (Fe-Sod) From The Hyperth 1e-05
2cw2_A 226 Crystal Structure Of Superoxide Dismutase From P. M 1e-05
1b06_A 210 Superoxide Dismutase From Sulfolobus Acidocaldarius 2e-05
1wb7_A 210 Iron Superoxide Dismutase (Fe-Sod) From The Hyperth 2e-05
2w7w_A 194 The Crystal Structure Of Iron Superoxide Dismutase 3e-05
2cw3_A 280 X-Ray Structure Of Pmsod2, Superoxide Dismutase Fro 1e-04
1qnn_A 191 Cambialistic Superoxide Dismutase From Porphyromona 1e-04
1ues_A 191 Crystal Structure Of Porphyromonas Gingivalis Sod L 1e-04
2bpi_A 206 Stucture Of Iron Dependent Superoxide Dismutase Fro 1e-04
2goj_A 197 The Crystal Structure Of The Enzyme Fe-Superoxide D 1e-04
2a03_A 206 Superoxide Dismutase Protein From Plasmodium Berghe 2e-04
1p7g_A 222 Crystal Structure Of Superoxide Dismutase From Pyro 2e-04
1my6_A 199 The 1.6 A Structure Of Fe-superoxide Dismutase From 2e-04
2awp_A 198 Crystal Structure Of Plasmodium Knowlesi Structure 8e-04
>pdb|1AR4|A Chain A, X-Ray Structure Analysis Of The Cambialistic Superoxide Dismutase From Propionibacterium Shermanii Active With Fe Or Mn Length = 201 Back     alignment and structure 
Iteration: 1

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/55 (61%), Positives = 43/55 (78%)
Query: 29 TLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTV 83
          TLP+LPYDYSALEP ISGEIM+LHH KHH+AYV   N A+++L +A +K D   +
Sbjct: 4  TLPELPYDYSALEPYISGEIMELHHDKHHKAYVDGANTALDKLAEARDKADFGAI 58
>pdb|3DC6|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 198 Back     alignment and structure
>pdb|3DC5|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 195 Back     alignment and structure
>pdb|3C3S|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1PL4|A Chain A, Crystal Structure Of Human Mnsod Y166f Mutant Length = 198 Back     alignment and structure
>pdb|2QKA|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>pdb|1EM1|A Chain A, X-Ray Crystal Structure For Human Manganese Superoxide Dismutase, Q143a Length = 198 Back     alignment and structure
>pdb|1MSD|A Chain A, Comparison Of The Crystal Structures Of Genetically Engineered Human Manganese Superoxide Dismutase And Manganese Superoxide Dismutase From Thermus Thermophilus. Differences In Dimer-Dimer Interactions. Length = 198 Back     alignment and structure
>pdb|1QNM|A Chain A, Human Manganese Superoxide Dismutase Mutant Q143n Length = 198 Back     alignment and structure
>pdb|1JA8|A Chain A, Kinetic Analysis Of Product Inhibition In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1N0J|A Chain A, The Structure Of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals A Novel Tetrameric Interface Of Two 4-Helix Bundles Length = 199 Back     alignment and structure
>pdb|2QKC|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>pdb|3C3T|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1VAR|A Chain A, Mitochondrial Manganese Superoxide Dismutase Variant With Ile 58 Replaced By Thr Length = 198 Back     alignment and structure
>pdb|1AP5|A Chain A, Tyr34->phe Mutant Of Human Mitochondrial Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1SZX|A Chain A, Role Of Hydrogen Bonding In The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|3EVK|A Chain A, Crystal Structure Of The Metal-Bound Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222 Back     alignment and structure
>pdb|1ZTE|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Suerpoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1PM9|A Chain A, Crystal Structure Of Human Mnsod H30n, Y166f Mutant Length = 198 Back     alignment and structure
>pdb|2GDS|A Chain A, Interrupting The Hydrogen Bonding Network At The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1LUW|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His 30 In Human Manganese Superoxide Dismutase: Insertion Of Val Cgamma Into The Substrate Access Channel Length = 198 Back     alignment and structure
>pdb|2ADP|A Chain A, Nitrated Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1ZUQ|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2P4K|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1ZSP|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|3RN4|A Chain A, Crystal Structure Of Iron-Substituted Sod2 From Saccharomyces Cerevisiae Length = 215 Back     alignment and structure
>pdb|3BFR|A Chain A, The Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 215 Back     alignment and structure
>pdb|1GN4|A Chain A, H145e Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|1GN3|A Chain A, H145q Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|1GN6|A Chain A, G152a Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|1GN2|A Chain A, S123c Mutant Of The Iron-Superoxide Dismutase From Mycobacterium Tuberculosis. Length = 207 Back     alignment and structure
>pdb|1IDS|A Chain A, X-Ray Structure Analysis Of The Iron-Dependent Superoxide Dismutase From Mycobacterium Tuberculosis At 2.0 Angstroms Resolutions Reveals Novel Dimer-Dimer Interactions Length = 207 Back     alignment and structure
>pdb|1N0N|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His30 In Human Manganese Superoxide Dismutase Length = 199 Back     alignment and structure
>pdb|3LSU|A Chain A, Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 207 Back     alignment and structure
>pdb|1Y67|A Chain A, Crystal Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans Length = 229 Back     alignment and structure
>pdb|1XIL|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3- Fluorotyrosine Length = 198 Back     alignment and structure
>pdb|3KKY|A Chain A, Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans In The Orthorhombic Space Group P212121: A Case Study Of Mistaken Identity Length = 211 Back     alignment and structure
>pdb|2CDY|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus Radiodurans Length = 231 Back     alignment and structure
>pdb|1KKC|A Chain A, Crystal Structure Of Aspergillus Fumigatus Mnsod Length = 221 Back     alignment and structure
>pdb|4E4E|A Chain A, Crystal Structure Of The Y34f Mutant Of Saccharomyces Cerevisiae Manganese Superoxide Dismutase Length = 207 Back     alignment and structure
>pdb|2RCV|A Chain A, Crystal Structure Of The Bacillus Subtilis Superoxide Dismutase Length = 202 Back     alignment and structure
>pdb|1XDC|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3- Fluorotyrosine Length = 198 Back     alignment and structure
>pdb|1GV3|A Chain A, The 2.0 Angstrom Resolution Structure Of The Catalytic Portion Of A Cyanobacterial Membrane-Bound Manganese Superoxide Dismutase Length = 248 Back     alignment and structure
>pdb|1EN6|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146l Mutant Length = 205 Back     alignment and structure
>pdb|1I0H|A Chain A, Crystal Structure Of The E. Coli Manganese Superoxide Dismutase Mutant Y174f At 1.35 Angstroms Resolution. Length = 205 Back     alignment and structure
>pdb|1VEW|A Chain A, Manganese Superoxide Dismutase From Escherichia Coli Length = 205 Back     alignment and structure
>pdb|1EN4|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146h Mutant Length = 205 Back     alignment and structure
>pdb|3AK1|A Chain A, Superoxide Dismutase From Aeropyrum Pernix K1, Apo-Form Length = 214 Back     alignment and structure
>pdb|3MDS|A Chain A, Maganese Superoxide Dismutase From Thermus Thermophilus Length = 203 Back     alignment and structure
>pdb|1EN5|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Y34f Mutant Length = 205 Back     alignment and structure
>pdb|4FFK|A Chain A, X-Ray Structure Of Iron Superoxide Dismutase From Acidilobus Saccharovorans Length = 223 Back     alignment and structure
>pdb|1XUQ|A Chain A, Crystal Structure Of Soda-1 (Ba4499) From Bacillus Anthracis At 1.8a Resolution. Length = 212 Back     alignment and structure
>pdb|1MA1|A Chain A, Structure And Properties Of The Atypical Iron Superoxide Dismutase From Methanobacterium Thermoautotrophicum Length = 205 Back     alignment and structure
>pdb|1I08|A Chain A, Crystal Structure Analysis Of The H30a Mutant Of Manganese Superoxide Dismutase From E. Coli Length = 205 Back     alignment and structure
>pdb|3QVN|A Chain A, Crystal Structure Of Cytosolic Mnsod3 From Candida Albicans Length = 206 Back     alignment and structure
>pdb|1JR9|A Chain A, Crystal Structure Of Manganese Superoxide Dismutases From Bacillus Halodenitrificans Length = 202 Back     alignment and structure
>pdb|3TQJ|A Chain A, Structure Of The Superoxide Dismutase (Fe) (Sodb) From Coxiella Burnetii Length = 210 Back     alignment and structure
>pdb|3TJT|A Chain A, Crystal Structure Analysis Of The Superoxide Dismutase From Clostridium Difficile Length = 208 Back     alignment and structure
>pdb|1XRE|A Chain A, Crystal Structure Of Soda-2 (Ba5696) From Bacillus Anthracis At 1.8a Resolution. Length = 217 Back     alignment and structure
>pdb|3H1S|A Chain A, Crystal Structure Of Superoxide Dismutase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 195 Back     alignment and structure
>pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of Recombinant Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 197 Back     alignment and structure
>pdb|3SDP|A Chain A, The 2.1 Angstroms Resolution Structure Of Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 195 Back     alignment and structure
>pdb|1ISA|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase: Comparisons With The Manganese Enzyme From T. Thermophilus Length = 192 Back     alignment and structure
>pdb|2NYB|A Chain A, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e At 1.1 Angstrom Resolution Length = 192 Back     alignment and structure
>pdb|1ZA5|A Chain A, Q69h-Fesod Length = 192 Back     alignment and structure
>pdb|3LIO|A Chain A, X-Ray Structure Of The Iron Superoxide Dismutase From Pseudoalteromonas Haloplanktis (Crystal Form I) Length = 192 Back     alignment and structure
>pdb|1WB8|A Chain A, Iron Superoxide Dismutase (Fe-Sod) From The Hyperthermophile Sulfolobus Solfataricus. 2.3 A Resolution Structure Of Recombinant Protein With A Covalently Modified Tyrosin In The Active Site. Length = 210 Back     alignment and structure
>pdb|2CW2|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Marinus Length = 226 Back     alignment and structure
>pdb|1B06|A Chain A, Superoxide Dismutase From Sulfolobus Acidocaldarius Length = 210 Back     alignment and structure
>pdb|1WB7|A Chain A, Iron Superoxide Dismutase (Fe-Sod) From The Hyperthermophile Sulfolobus Solfataricus. Crystal Structure Of The Y41f Mutant. Length = 210 Back     alignment and structure
>pdb|2W7W|A Chain A, The Crystal Structure Of Iron Superoxide Dismutase From Aliivibrio Salmonicida. Length = 194 Back     alignment and structure
>pdb|2CW3|A Chain A, X-Ray Structure Of Pmsod2, Superoxide Dismutase From Perkinsus Marinus Length = 280 Back     alignment and structure
>pdb|1QNN|A Chain A, Cambialistic Superoxide Dismutase From Porphyromonas Gingivalis Length = 191 Back     alignment and structure
>pdb|1UES|A Chain A, Crystal Structure Of Porphyromonas Gingivalis Sod Length = 191 Back     alignment and structure
>pdb|2BPI|A Chain A, Stucture Of Iron Dependent Superoxide Dismutase From P. Falciparum. Length = 206 Back     alignment and structure
>pdb|2GOJ|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Plasmodium Falciparum Length = 197 Back     alignment and structure
>pdb|2A03|A Chain A, Superoxide Dismutase Protein From Plasmodium Berghei Length = 206 Back     alignment and structure
>pdb|1P7G|A Chain A, Crystal Structure Of Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222 Back     alignment and structure
>pdb|1MY6|A Chain A, The 1.6 A Structure Of Fe-superoxide Dismutase From The Thermophilic Cyanobacterium Thermosynechococcus Elongatus : Correlation Of Epr And Structural Characteristics Length = 199 Back     alignment and structure
>pdb|2AWP|A Chain A, Crystal Structure Of Plasmodium Knowlesi Structure Of Iron Super-Oxide Dismutase Length = 198 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
3qvn_A 206 Manganese-containing superoxide dismutase; Mn supe 4e-33
1kkc_A 221 Mnsod, manganese superoxide dismutase; homotetrame 2e-32
1bsm_A 201 Superoxide dismutase; oxidoreductase; 1.35A {Propi 3e-32
1b06_A 210 Protein (superoxide dismutase); oxidoreductase; 2. 3e-32
1pl4_A 198 Superoxide dismutase [MN], mitochondrial; oxidored 3e-32
4ffk_A 223 Superoxide dismutase; oxidoreductase, superoxide a 4e-32
3dc5_A 195 Superoxide dismutase [MN] 2; alpha hairpin N domai 4e-32
1ids_A 207 Iron superoxide dismutase; 2.00A {Mycobacterium tu 6e-32
3ak2_A 214 Superoxide dismutase [MN/FE]; cambialistic, oxidor 2e-31
1ma1_A 205 Superoxide dismutase; metal specificity, azide inh 2e-31
3rn4_A 215 Superoxide dismutase [MN], mitochondrial; mitochon 8e-31
1mng_A 203 Manganese superoxide dismutase; oxidoreductase(sup 2e-29
1xre_A 217 SODA-2, superoxide dismutase; spine, oxidoreductas 3e-29
1ix9_A 205 Mnsod, superoxide dismutase; manganese superoxide 6e-29
1gv3_A 248 Manganese superoxide dismutase; anabaena PCC 7120, 1e-26
3kky_A 211 Mnsod, superoxide dismutase [MN]; manganese, ME bi 9e-26
2rcv_A 202 Superoxide dismutase [MN]; bacillus subtilis,super 1e-25
2cw3_A 280 Pmsod2, iron superoxide dismutase; oxidoreductase; 9e-25
2cw2_A 226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A 7e-24
2gpc_A 194 Iron superoxide dismutase; alpha+beta structure, o 8e-24
1uer_A 191 SOD, superoxide dismutase; metal-specific, cambial 2e-23
2awp_A 198 Iron super-oxide dismutase; structural genomics, s 2e-23
1dt0_A 197 Superoxide dismutase; pseudomonas ovalis, oxidored 2e-23
3lio_A 192 Iron superoxide dismutase; cold adaptation, flexib 5e-23
2nyb_A 192 Superoxide dismutase [FE]; iron superoxide dismuta 6e-23
3cei_A 213 Superoxide dismutase; oxidoreductase; 2.40A {Helic 6e-23
4f2n_A 230 Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em 2e-22
3h1s_A 195 Superoxide dismutase; SOBD, csgid, oxidoreductase, 2e-22
3tqj_A 210 Superoxide dismutase [FE]; oxidoreductase; 2.00A { 5e-22
1unf_X 238 Iron superoxide dismutase; oxidoreductase, eukaryo 2e-21
1coj_A 212 Protein (superoxide dismutase); oxidoreductase; 1. 2e-21
3js4_A 227 Superoxide dismutase; niaid, ssgcid, seattle struc 6e-21
1my6_A 199 Iron (III) superoxide dismutase; iron speroxide di 7e-21
>3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Length = 206 Back     alignment and structure
 Score =  111 bits (281), Expect = 4e-33
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 26 QTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTVV 84
          + ++LP + +   ALEP IS EI  LH  KHH AYV  YN A++ L +A+ K D  +VV
Sbjct: 6  EKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVV 64
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Length = 221 Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Length = 201 Back     alignment and structure
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Length = 210 Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Length = 198 Back     alignment and structure
>4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Length = 223 Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Length = 195 Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Length = 207 Back     alignment and structure
>3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Length = 214 Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Length = 205 Back     alignment and structure
>3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* Length = 215 Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Length = 203 Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Length = 217 Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Length = 205 Back     alignment and structure
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Length = 248 Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Length = 211 Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Length = 202 Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Length = 280 Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Length = 226 Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Length = 194 Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Length = 191 Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Length = 198 Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Length = 197 Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Length = 192 Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Length = 192 Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Length = 213 Back     alignment and structure
>4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Length = 230 Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Length = 195 Back     alignment and structure
>3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Length = 210 Back     alignment and structure
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Length = 238 Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Length = 212 Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Length = 227 Back     alignment and structure
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Length = 199 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
3dc5_A 195 Superoxide dismutase [MN] 2; alpha hairpin N domai 99.9
3qvn_A 206 Manganese-containing superoxide dismutase; Mn supe 99.9
1ids_A 207 Iron superoxide dismutase; 2.00A {Mycobacterium tu 99.89
4ffk_A 223 Superoxide dismutase; oxidoreductase, superoxide a 99.88
3rn4_A 215 Superoxide dismutase [MN], mitochondrial; mitochon 99.88
3tjt_A 208 Superoxide dismutase; metal ION binding, rossmann 99.88
1pl4_A 198 Superoxide dismutase [MN], mitochondrial; oxidored 99.88
4h3e_A 241 Fesod, superoxide dismutase; structural genomics, 99.88
1kkc_A 221 Mnsod, manganese superoxide dismutase; homotetrame 99.87
1bsm_A 201 Superoxide dismutase; oxidoreductase; 1.35A {Propi 99.87
1ma1_A 205 Superoxide dismutase; metal specificity, azide inh 99.87
3ak2_A 214 Superoxide dismutase [MN/FE]; cambialistic, oxidor 99.87
3kky_A 211 Mnsod, superoxide dismutase [MN]; manganese, ME bi 99.86
3h1s_A 195 Superoxide dismutase; SOBD, csgid, oxidoreductase, 99.86
1b06_A 210 Protein (superoxide dismutase); oxidoreductase; 2. 99.86
2awp_A 198 Iron super-oxide dismutase; structural genomics, s 99.85
2rcv_A 202 Superoxide dismutase [MN]; bacillus subtilis,super 99.85
1ix9_A 205 Mnsod, superoxide dismutase; manganese superoxide 99.85
3tqj_A 210 Superoxide dismutase [FE]; oxidoreductase; 2.00A { 99.85
1uer_A 191 SOD, superoxide dismutase; metal-specific, cambial 99.85
1mng_A 203 Manganese superoxide dismutase; oxidoreductase(sup 99.85
2nyb_A 192 Superoxide dismutase [FE]; iron superoxide dismuta 99.85
1xre_A 217 SODA-2, superoxide dismutase; spine, oxidoreductas 99.84
3lio_A 192 Iron superoxide dismutase; cold adaptation, flexib 99.84
1my6_A 199 Iron (III) superoxide dismutase; iron speroxide di 99.84
2gpc_A 194 Iron superoxide dismutase; alpha+beta structure, o 99.84
1dt0_A 197 Superoxide dismutase; pseudomonas ovalis, oxidored 99.84
2cw2_A 226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A 99.83
1unf_X 238 Iron superoxide dismutase; oxidoreductase, eukaryo 99.83
3cei_A 213 Superoxide dismutase; oxidoreductase; 2.40A {Helic 99.83
4f2n_A 230 Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em 99.83
1gv3_A 248 Manganese superoxide dismutase; anabaena PCC 7120, 99.82
1coj_A 212 Protein (superoxide dismutase); oxidoreductase; 1. 99.8
3js4_A 227 Superoxide dismutase; niaid, ssgcid, seattle struc 99.77
2cw3_A 280 Pmsod2, iron superoxide dismutase; oxidoreductase; 99.77
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Back     alignment and structure
Probab=99.90  E-value=1.8e-24  Score=156.91  Aligned_cols=56  Identities=57%  Similarity=0.896  Sum_probs=50.6

Q ss_pred             ceeCCCCCCCcCcccccccHHHHHHHHHhhHHHHHHHHHHHHHHHHHhhccCCcCc
Q 036366           27 TVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTST   82 (84)
Q Consensus        27 ~f~Lp~LpY~y~aLeP~IS~~tm~~Hy~kHH~~YV~~lN~~~~~~~~~~~~~~~~~   82 (84)
                      +|+||+|||+|+||||+||++||++||+|||++||+|||++++++.+....+++++
T Consensus         2 ~~~Lp~LpY~~~aLeP~is~~tm~~Hh~kHh~~YV~~LN~~~~~~~~~~~~~~~~~   57 (195)
T 3dc5_A            2 KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKE   57 (195)
T ss_dssp             CCCCCCCSSCTTTTTTTSCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHTCHHH
T ss_pred             CCcCCCCCCCcccccccCCHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHhcCCHHH
Confidence            68999999999999999999999999999999999999999998876666655543
>3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Back     alignment and structure
>4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Back     alignment and structure
>3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* 4e4e_A* Back     alignment and structure
>3tjt_A Superoxide dismutase; metal ION binding, rossmann fold, oxidoreductase; 1.80A {Clostridium difficile} Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Back     alignment and structure
>4h3e_A Fesod, superoxide dismutase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Trypanosoma cruzi} Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Back     alignment and structure
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Back     alignment and structure
>3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Back     alignment and structure
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Back     alignment and structure
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Back     alignment and structure
>4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Back     alignment and structure
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
d1ix9a190 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) 2e-23
d1jr9a190 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) 3e-22
d1bsma186 a.2.11.1 (A:1-86) Cambialistic superoxide dismutas 6e-22
d1gv3a1102 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD 8e-22
d1kkca184 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) 2e-21
d1wb8a189 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) 2e-21
d2nyba182 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) 3e-21
d1mnga192 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) 3e-21
d1idsa184 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) 6e-21
d1p7ga192 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD 9e-21
d2p4ka183 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) 1e-20
d1ma1a188 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) 2e-20
d1uera184 a.2.11.1 (A:1-84) Cambialistic superoxide dismutas 1e-19
d1unfx191 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD 3e-19
d1my6a188 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) 8e-19
d1coja189 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) 1e-12
>d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 90 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Fe,Mn superoxide dismutase (SOD), N-terminal domain
family: Fe,Mn superoxide dismutase (SOD), N-terminal domain
domain: Mn superoxide dismutase (MnSOD)
species: Escherichia coli [TaxId: 562]

 Score = 83.1 bits (205), Expect = 2e-23
 Identities = 26/55 (47%), Positives = 32/55 (58%)

Query: 29 TLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNKVDTSTV 83
          TLP LPY Y ALEP    + M++HH KHHQ YV N N A+E L +  N      +
Sbjct: 3  TLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELI 57
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 90 Back     information, alignment and structure
>d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 86 Back     information, alignment and structure
>d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 102 Back     information, alignment and structure
>d1kkca1 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 84 Back     information, alignment and structure
>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 89 Back     information, alignment and structure
>d2nyba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 82 Back     information, alignment and structure
>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 92 Back     information, alignment and structure
>d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 84 Back     information, alignment and structure
>d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 92 Back     information, alignment and structure
>d2p4ka1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 88 Back     information, alignment and structure
>d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 84 Back     information, alignment and structure
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 91 Back     information, alignment and structure
>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 88 Back     information, alignment and structure
>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d1wb8a189 Fe superoxide dismutase (FeSOD) {Archaeon Sulfolob 99.94
d1idsa184 Fe superoxide dismutase (FeSOD) {Mycobacterium tub 99.94
d1bsma186 Cambialistic superoxide dismutase {Propionibacteri 99.93
d1p7ga192 Fe superoxide dismutase (FeSOD) {Archaeon Pyrobacu 99.93
d1kkca184 Mn superoxide dismutase (MnSOD) {Aspergillus fumig 99.93
d1ma1a188 Fe superoxide dismutase (FeSOD) {Archaeon Methanob 99.93
d2p4ka183 Mn superoxide dismutase (MnSOD) {Human (Homo sapie 99.93
d1mnga192 Mn superoxide dismutase (MnSOD) {Thermus thermophi 99.92
d1ix9a190 Mn superoxide dismutase (MnSOD) {Escherichia coli 99.92
d1uera184 Cambialistic superoxide dismutase {Porphyromonas g 99.92
d2nyba182 Fe superoxide dismutase (FeSOD) {Escherichia coli 99.92
d1jr9a190 Mn superoxide dismutase (MnSOD) {Bacillus halodeni 99.91
d1gv3a1102 Mn superoxide dismutase (MnSOD) {Anabaena sp. [Tax 99.91
d1unfx191 Fe superoxide dismutase (FeSOD) {Cowpea (Vigna ung 99.91
d1my6a188 Fe superoxide dismutase (FeSOD) {Thermosynechococc 99.91
d1coja189 Fe superoxide dismutase (FeSOD) {Aquifex pyrophilu 99.66
>d1wb8a1 a.2.11.1 (A:4-92) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Fe,Mn superoxide dismutase (SOD), N-terminal domain
family: Fe,Mn superoxide dismutase (SOD), N-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=99.94  E-value=2.5e-27  Score=152.15  Aligned_cols=53  Identities=38%  Similarity=0.664  Sum_probs=48.9

Q ss_pred             ccceeCCCCCCCcCcccccccHHHHHHHHHhhHHHHHHHHHHHHHHHHHhhcc
Q 036366           25 LQTVTLPDLPYDYSALEPAISGEIMQLHHQKHHQAYVTNYNKAVEQLFQALNK   77 (84)
Q Consensus        25 ~~~f~Lp~LpY~y~aLeP~IS~~tm~~Hy~kHH~~YV~~lN~~~~~~~~~~~~   77 (84)
                      +|+|+||+|||+|+||||+||++||++||+|||++||++||+++++.++....
T Consensus         3 ~~~f~Lp~LPY~~~aLeP~Is~~Tm~~Hh~kHH~~YV~~lN~~l~~~~~~~~~   55 (89)
T d1wb8a1           3 FKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEKVVKG   55 (89)
T ss_dssp             CCCCCCCCCSSCTTTTTTTSCHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CccccCCCCCCCccccccccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            56899999999999999999999999999999999999999999987765543
>d1idsa1 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bsma1 a.2.11.1 (A:1-86) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1p7ga1 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kkca1 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ma1a1 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2p4ka1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ix9a1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uera1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2nyba1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1gv3a1 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Back     information, alignment and structure
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Back     information, alignment and structure
>d1my6a1 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure