Citrus Sinensis ID: 036393

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690--

MACTTVTIPTSPVGTAAKDTFKEYNGLRRSESGNDLCKRAGMQRSYSDNNLCYSVNRIRAASKSPKLKSSPSVGLFPLQCQLSSSIIPNSVRSFLFDPETSKDMSIVDKKMNVIEDLAESNEEEMKIKKANWVERLMQIREEWVKRQQQQSVDGEEVGDEDEKGFCDPDACKGGCEVDYGSDNDGDEIRYDHESFSRLLAEVPLSDTKLFSQLAFLSNMAYVIPEIKFVTSSLEKKAEAAAIKVKLKLDSTHVPVNNQSASESDTEKHVDSELRTSSRPFVASKIAASAASYVQSHAKDLMSLGCEPQEDTGINPFEIEDQQQGDGGNSRVYKSEVAAYVAASTMTAVVAAGEKEKQEAAKDLQSLHSSPCEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQPDEKLSPSHPLLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSRMDHTRMVFCKARKQKNMLWPLLTSPSPHSWSHEYSLQSTSFISKEVMTGV

cccccccccccccccccHHHHHHccccccccccHHHHHHcccEEccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHcHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHcccccccccEEEEccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHccHHHHHHHHHHHHccccccccEEEEEEEccccEEEEEEcccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHcccccccccccEEEEcccccccccHHHHHHHccccccEEEEEEcccccccccccccccccHHHEEccccccccccccccccccccccccEEEEccccccccccccccccccEEEEccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc

cccEEEEEccccccHHHHHHHHHHcccccccccccHHHcccEEEEccccccccccccEEEccccccccccccEEEEEcEccccccccccccccEEEcccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHcccccHHHHccccccccccccccccccccccccccccccccccccEEEcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccccccccHHcccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHEccHHHHHHHHHHHccccccccEEEEEEcccccEEEEEEEccccHHHHHHHHcccccEEccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHccccHHHcccEEEcccccEEccHHHHHHHHccccHHHHHHHHHccccccEEcccccHHHHHHHHHHccccccccccccccEEEccccEEEEEcccccccccccccccccEEEEEccccHHHHHHHHHHHHccccccHHccccccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEHHHEccccccccccHccHHccccEEEEEEccc

macttvtiptspvgtaakdtfkeynglrrsesgndlckragmqrsysdnnlcysvnriraaskspklksspsvglfplqcqlsssiipnsvrsflfdpetskdmsivDKKMNVIEDLAESNEEEMKIKKANWVERLMQIREEWVKRQQqqsvdgeevgdedekgfcdpdackggcevdygsdndgdeirydHESFSRLlaevplsdtklfSQLAFLSNMAYVIPEIKFVTSSLEKKAEAAAIKVKLKLdsthvpvnnqsasesdtekhvdselrtssrpfvaSKIAASAASYVQSHAKDlmslgcepqedtginpfeiedqqqgdggnsrvYKSEVAAYVAASTMTAVVAAGEKEKQEAAKDLqslhsspcewfvcddfrtytrCFVIQGSDSLASWQAnlffeptefegtdvlVHRGIYEAAKGIYEQFMPEIMDHLNRhgeraklqftghslgGSLSLLVSLMLLnqgivkpstlrpivtfgspfvfcggqkllnylgldenhvhcvmmhrdivprafscsypNHVALVLKRLsgtfrshpclnknkllysplgklfilqpdeklspshpllppgnalyvldkmkcgystSALRFflnwphplatlsdptaygsdgtilrdhdssnyLKAVHGVLrqhsrmdhtRMVFCKARkqknmlwplltspsphswsheyslqstsfiskevmtgv

macttvtiptspvgtaakdtfkeynglrrsesgndlCKRAGmqrsysdnnlcYSVNRIRAASKSPKLKSSPSVGLFPLQCQLSSSIIPNSVRSFLFdpetskdmsivdkKMNVIEDLaesneeemkikkANWVERLMQIREEWVkrqqqqsvdgeevgdedekgfcdpdackgGCEVDYGSDNDGDEIRYDHESFSRLLAEVPLSDTKLFSQLAFLSNMAYVIPEIKFVTSSLEKKAEAAAIKVklkldsthvpvnnqsasesdtekhvdseLRTSSRPFVASKIAASAASYVQSHAKDLMSLGCEPQEDTGINPFEIEDQQQGDGGNSRVYKSEVAAYVAASTMTAVVAAGEKEKQEAAKDLQSLHSSPCEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQPDEKLSPSHPLLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVlrqhsrmdHTRMVFCKARKQKNMLWPLLTSPSPHSWSHeyslqstsfiskevmtgv

MACTTVTIPTSPVGTAAKDTFKEYNGLRRSESGNDLCKRAGMQRSYSDNNLCYSVNRIRAAskspklksspsVGLFPLQCQLSSSIIPNSVRSFLFDPETSKDMSIVDKKMNVIEDLAESNEEEMKIKKANWVERLMQIREEWVKRQQQQSvdgeevgdedeKGFCDPDACKGGCEVDYGSDNDGDEIRYDHESFSRLLAEVPLSDTKLFSQLAFLSNMAYVIPEIKFVTSSlekkaeaaaikvklklDSTHVPVNNQSASESDTEKHVDSELRTSSRPFVASKIAASAASYVQSHAKDLMSLGCEPQEDTGINPFEIEDQQQGDGGNSRVYKSEvaayvaastmtavvaagekekqeaakDLQSLHSSPCEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHslggslsllvslmllNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQPDEKLSPSHPLLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSRMDHTRMVFCKARKQKNMLWPLLTSPSPHSWSHEYSLQSTSFISKEVMTGV

*************************************************NLCYSVNR****************GLFPLQCQLSSSIIPNSVRSFLF********************************KANWVERLMQIREEWV*********************CDPDACKGGCEVDYGS***GDEIRYDHESFSRLLAEVPLSDTKLFSQLAFLSNMAYVIPEIKFVTSSLEKKAEAAAIKVKL*************************************************************************************YKSEVAAYVAASTMTAVVA******************SPCEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQP*********LLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSRMDHTRMVFCKARKQKNMLWPLLT***************************

*******************TF**YN******************RSYSDNNLCY*V*************************************SFLFDPET*********************************ERLM***********************************************GDEIRYDHESFSRLLAEVPLSDTKLFSQLAFLSNMAYVIPEIKFVT*******************************************************AASAASYVQSHA***********************QQQGDGGNSRVYKSEVAAYVAASTMTAVVAAGEKEKQEAAKDLQSLHSSPCEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQPDEKLSPSHPLLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLR****************KQKNMLWPLLT*****************FISKEVMT**

MACTTVTIPTSPVGTAAKDTFKEYNGLRRSESGNDLCKRAGMQRSYSDNNLCYSVNRIRA***********SVGLFPLQCQLSSSIIPNSVRSFLFDPETSKDMSIVDKKMNVIEDLAESNEEEMKIKKANWVERLMQIREEW*******************KGFCDPDACKGGCEVDYGSDNDGDEIRYDHESFSRLLAEVPLSDTKLFSQLAFLSNMAYVIPEIKFVTSSLEKKAEAAAIKVKLKLDSTHVP********************TSSRPFVASKIAASAASYVQSHAKDLMSLGCEPQEDTGINPFEIEDQ********RVYKSEVAAYVAASTMTAVVAAG*************LHSSPCEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQPDEKLSPSHPLLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSRMDHTRMVFCKARKQKNMLWPLLTSP**********LQSTSFISKEVMTGV

*ACTTVTIPTSPVGTAAKDTFKEYNGLRRSESGNDLCKRAGMQRSYSDNNLCYSVNRIRAASKSPKLKSSPSVGLFPLQCQLSSSIIPNSVRSFLFDPETSKDMSIVDK********************ANWVERLMQIREEWVK***************************GGCEVDYGSDNDGDEIRYDHESFSRLLAEVPLSDTKLFSQLAFLSNMAYVIPEIKFVTSSLEKKAEAA***********************************SSRPFVASKIAASAASYVQSHAKDLMSLG*****************************************************EA*KDLQSLHSSPCEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQPDEKLSPSHPLLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSRMDHTRMVFCKARKQKNMLWPLLTSPSPHSWSHEYSLQSTSFISKEVMTG*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		692	2.2.26 [Sep-21-2011]
P19515		363	Lipase OS=Rhizomucor mieh	N/A	no	0.187	0.358	0.297	3e-05

>sp\|P19515\|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2	Back alignment and function desciption

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 65/138 (47%), Gaps = 8/138 (5%)

Query: 383 TRCFVIQGSDSLASWQANLFFEPTEF---EGTDVLVHRGIYEAAKGIYEQFMPEIMDHLN 439
           T   V +GS S+ +W A+L F P  +    GT V  H+G  ++   +  + +  ++D   
Sbjct: 168 TIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTKV--HKGFLDSYGEVQNELVATVLDQFK 225

Query: 440 RHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYL 499
           ++    K+  TGHSLGG+ +LL +L L  +     S+   + T G P V  G     NY+
Sbjct: 226 QY-PSYKVAVTGHSLGGATALLCALDLYQREEGLSSSNLFLYTQGQPRV--GDPAFANYV 282

Query: 500 GLDENHVHCVMMHRDIVP 517
                     +  RDIVP
Sbjct: 283 VSTGIPYRRTVNERDIVP 300

Rhizomucor miehei (taxid: 4839)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 3

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		692
224127911		691	predicted protein [Populus trichocarpa]	0.965	0.966	0.657	0.0
224064210		666	predicted protein [Populus trichocarpa]	0.945	0.981	0.650	0.0
147833693		681	hypothetical protein VITISV_014668 [Viti	0.958	0.973	0.657	0.0
359489719		655	PREDICTED: uncharacterized protein LOC10	0.926	0.978	0.650	0.0
297745422		650	unnamed protein product [Vitis vinifera]	0.906	0.964	0.658	0.0
255564745		671	triacylglycerol lipase, putative [Ricinu	0.945	0.974	0.630	0.0
357512553		695	hypothetical protein MTR_7g117280 [Medic	0.984	0.979	0.606	0.0
324329841		694	triacylglycerol lipase 1 [Arachis hypoga	0.975	0.972	0.604	0.0
449443943		675	PREDICTED: uncharacterized protein LOC10	0.942	0.965	0.602	0.0
356522520		670	PREDICTED: uncharacterized protein LOC10	0.908	0.938	0.549	0.0

>gi\|224127911\|ref\|XP_002320194.1\| predicted protein [Populus trichocarpa] gi\|222860967\|gb\|EEE98509.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/710 (65%), Positives = 544/710 (76%), Gaps = 42/710 (5%)

Query: 6   VTIPTSPVGTAAKDTFKEYNGLRRSESGNDLCKRAGMQRSYSDNNLCYSVNRIRAASKSP 65
           + IP+S    A KD FKE+NGL RS SG D C RA M+RSYSDN+LCYSVN +RAAS  P
Sbjct: 1   MAIPSSQATVAQKDRFKEHNGLYRSNSGKDFCNRATMRRSYSDNHLCYSVNYVRAASSQP 60

Query: 66  KLKSSPSVGLFPLQCQLSSSIIPNSVRSFLFDPETSKDMSI----VDKKMNVIEDLAESN 121
           KLKSS SVG+FP Q  +SSSIIP S+RSFLFDPETSKDM+I    VD  +   E + +S+
Sbjct: 61  KLKSSRSVGIFPFQ--ISSSIIPASLRSFLFDPETSKDMNIAKDGVDGSLKKDEIIVDSS 118

Query: 122 EE-----EM-KIKKANWVERLMQIREEWVKRQQQQSVDGEE-VGDEDEKGFCDPDACKGG 174
           +E     E+ ++K+ NWVER+ +IR  W  RQQ++ + GEE + D  + G  +   C+ G
Sbjct: 119 DEGSASTELGEVKRTNWVERIYEIRNHWRNRQQKEDIYGEEELSDASKNGDSN---CEDG 175

Query: 175 CEVDYGSDNDGDEIRYDHESFSRLLAEVPLSDTKLFSQLAFLSNMAYVIPEIK------- 227
           C VDY SD +G EI+YD E+F R LA V  SDTKL S+LAFL NMAYVI EIK       
Sbjct: 176 CMVDYNSDEEGGEIKYDRETFLRFLAPVGWSDTKLLSKLAFLCNMAYVIQEIKAMDLRRY 235

Query: 228 ----FVTSSLEKKAEAAAIKVKLKLDSTHVPVNNQSASESDTEKHVDSELRTSSRPFVAS 283
               FVTSSLEKKAEAAA+K KL  D+TH P      ++S++    + E +   R  +A 
Sbjct: 236 YGLHFVTSSLEKKAEAAAVKEKLDHDATHAPAATLVVAKSNSGNTEEPEQKHPIRSSLAY 295

Query: 284 KIAASAASYVQSHAKDLMSLGCEPQEDTGINPFEIEDQQQGDGGN-SRVYKSEVAAYVAA 342
            IAASAASYVQS A+ L+S G +PQ+         EDQ   DG    RVYKSEVAAYVAA
Sbjct: 296 GIAASAASYVQSRAQGLLSHGIQPQQ---------EDQPVEDGERPQRVYKSEVAAYVAA 346

Query: 343 STMTAVVAAGEKEKQEAAKDLQSLHSSPCEWFVCDDFRTYTRCFVIQGSDSLASWQANLF 402
           STMTA+VAAGEKEKQEAA+DLQSLHS+PCEWFVCDD  TYTRCFVIQGSDSLASWQANL 
Sbjct: 347 STMTAMVAAGEKEKQEAARDLQSLHSAPCEWFVCDDVSTYTRCFVIQGSDSLASWQANLL 406

Query: 403 FEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHSLGGSLSLLV 462
           FEPT+FEGTDVLVHRGIYEAAKGIYEQFMPEIM+HLN+HGERAKLQFTGHSLGGSLSLLV
Sbjct: 407 FEPTKFEGTDVLVHRGIYEAAKGIYEQFMPEIMEHLNKHGERAKLQFTGHSLGGSLSLLV 466

Query: 463 SLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSC 522
            LMLL + IVK S LRP+VTFGSPFVFCGGQK+LNYLGLD+NHVHCV+MHRDIVPRAFSC
Sbjct: 467 HLMLLTRKIVKTSALRPVVTFGSPFVFCGGQKILNYLGLDDNHVHCVVMHRDIVPRAFSC 526

Query: 523 SYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQPDEKLSPSHPLLPPGNALYV 582
           +YPNHV LVLKRL+G+F+SHPCL KNK LYSPLGKLFILQPDEK SP HPLLPPG+ALY 
Sbjct: 527 NYPNHVTLVLKRLNGSFQSHPCLTKNKFLYSPLGKLFILQPDEKSSPPHPLLPPGSALYA 586

Query: 583 LDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSR 642
            DK +  ++ SA++ FLN PHPL TLSDPTAYGS+GTILRDHDSSNYLKAV+ VLRQ+S 
Sbjct: 587 FDKTQHRFAASAIKAFLNCPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNKVLRQNS- 645

Query: 643 MDHTRMVFCKARKQKNMLWPLLTSPSPHSWSHEYSLQSTSFISKEVMTGV 692
               +MV  K  +  N LWPLL SPSPH W+HE +L+ + F +K+ MTGV
Sbjct: 646 ----KMVGWKVHEWGNQLWPLLASPSPHLWNHENTLERSMFGTKKAMTGV 691

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224064210\|ref\|XP_002301404.1\| predicted protein [Populus trichocarpa] gi\|222843130\|gb\|EEE80677.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147833693\|emb\|CAN64332.1\| hypothetical protein VITISV_014668 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359489719\|ref\|XP_002277012.2\| PREDICTED: uncharacterized protein LOC100256908 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297745422\|emb\|CBI40502.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255564745\|ref\|XP_002523367.1\| triacylglycerol lipase, putative [Ricinus communis] gi\|223537455\|gb\|EEF39083.1\| triacylglycerol lipase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357512553\|ref\|XP_003626565.1\| hypothetical protein MTR_7g117280 [Medicago truncatula] gi\|355501580\|gb\|AES82783.1\| hypothetical protein MTR_7g117280 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|324329841\|gb\|ADY38373.1\| triacylglycerol lipase 1 [Arachis hypogaea]	Back alignment and taxonomy information

>gi\|449443943\|ref\|XP_004139735.1\| PREDICTED: uncharacterized protein LOC101208871 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356522520\|ref\|XP_003529894.1\| PREDICTED: uncharacterized protein LOC100796262 [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		692
TAIR\|locus:2076785		649	AT3G61680 [Arabidopsis thalian	0.478	0.510	0.639	3.6e-161
TAIR\|locus:2196045		713	AT1G02660 [Arabidopsis thalian	0.768	0.746	0.394	4.9e-101
TAIR\|locus:2081720		649	AT3G62590 [Arabidopsis thalian	0.401	0.428	0.568	8.6e-100

TAIR\|locus:2076785 AT3G61680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1172 (417.6 bits), Expect = 3.6e-161, Sum P(2) = 3.6e-161
 Identities = 215/336 (63%), Positives = 256/336 (76%)

Query:   331 VYKSEXXXXXXXXXXXXXXXXXXXXXXXXXXDLQSLHSSPCEWFVCDDFRTYTRCFVIQG 390
             +YKS                           +LQSL SSPCEWFVCDD  TYTRCFVIQG
Sbjct:   300 IYKSAAAAQAAASTMTAVVAAGEEEKLEAARELQSLQSSPCEWFVCDDPNTYTRCFVIQG 359

Query:   391 SDSLASWQANLFFEPTEFEGTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFT 450
             SDSLASW+ANLFFEPT+FE TDVLVHRGIYEAAKGIYEQF+PEI +HL+RHG+RAK QFT
Sbjct:   360 SDSLASWKANLFFEPTKFEDTDVLVHRGIYEAAKGIYEQFLPEITEHLSRHGDRAKFQFT 419

Query:   451 GHXXXXXXXXXXXXXXXNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVM 510
             GH               ++G+V    ++ +VTFGSPFVFCGG+K+L  LGLDE+HVHCVM
Sbjct:   420 GHSLGGSLSLIVNLMLISRGLVSSEAMKSVVTFGSPFVFCGGEKILAELGLDESHVHCVM 479

Query:   511 MHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQPDEKLSPS 570
             MHRDIVPRAFSC+YP+HVALVLKRL+G+FR+HPCLNKNKLLYSP+GK++ILQP E +SP+
Sbjct:   480 MHRDIVPRAFSCNYPDHVALVLKRLNGSFRTHPCLNKNKLLYSPMGKVYILQPSESVSPT 539

Query:   571 HPLLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDPTAYGSDGTILRDHDSSNYL 630
             HP LPPGNALY+L+    GYS +ALR FLN PHPL TLS   AYGS+G++LRDHDS NY+
Sbjct:   540 HPWLPPGNALYILENSNEGYSPTALRAFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYV 599

Query:   631 KAVHGVLRQHSRMDHTRMVFCKARKQKNMLWPLLTS 666
             KAV+GVLRQH     T+++  KAR Q+  +WP+LTS
Sbjct:   600 KAVNGVLRQH-----TKLIVRKARIQRRSVWPVLTS 630

GO:0004806 "triglyceride lipase activity" evidence=IEA;ISS

GO:0006629 "lipid metabolic process" evidence=IEA;ISS

TAIR\|locus:2196045 AT1G02660 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2081720 AT3G62590 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		692
cd00519		229	cd00519, Lipase_3, Lipase (class 3)	1e-33
pfam01764		141	pfam01764, Lipase_3, Lipase (class 3)	3e-32
cd00741		153	cd00741, Lipase, Lipase	5e-18
PLN02934		515	PLN02934, PLN02934, triacylglycerol lipase	5e-05
PLN02310		405	PLN02310, PLN02310, triacylglycerol lipase	0.001

>gnl\|CDD\|238287 cd00519, Lipase_3, Lipase (class 3)	Back alignment and domain information

 Score =  128 bits (323), Expect = 1e-33
 Identities = 60/196 (30%), Positives = 88/196 (44%), Gaps = 13/196 (6%)

Query: 337 AAY-VAASTMTAVVAAGEKEKQEA---AKDLQSLHSSPCEWFVCDDFRTYTRCFVIQGSD 392
           AAY V A+ +   V   +          K L++      + +V  D    T     +G+ 
Sbjct: 14  AAYCVDANILAKAVVFADIALLNVFSPDKLLKTDKQYDTQGYVAVDHDRKTIVIAFRGTV 73

Query: 393 SLASWQANLFFEPTEFE---GTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQF 449
           SLA W  +L F P   +    +   VH G Y A K +Y Q +PE+   L ++    K+  
Sbjct: 74  SLADWLTDLDFSPVPLDPPLCSGGKVHSGFYSAYKSLYNQVLPELKSALKQY-PDYKIIV 132

Query: 450 TGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCV 509
           TGHSLGG+L+ L++L L  +G   P +   + TFG P V  G      YL   +  V+ V
Sbjct: 133 TGHSLGGALASLLALDLRLRG---PGSDVTVYTFGQPRV--GNAAFAEYLESTKGRVYRV 187

Query: 510 MMHRDIVPRAFSCSYP 525
           +   DIVPR    S  
Sbjct: 188 VHGNDIVPRLPPGSLT 203

Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. . Length = 229

>gnl\|CDD\|216688 pfam01764, Lipase_3, Lipase (class 3)	Back alignment and domain information

>gnl\|CDD\|238382 cd00741, Lipase, Lipase	Back alignment and domain information

>gnl\|CDD\|215504 PLN02934, PLN02934, triacylglycerol lipase	Back alignment and domain information

>gnl\|CDD\|215176 PLN02310, PLN02310, triacylglycerol lipase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		692
PLN02934		515	triacylglycerol lipase	100.0
PLN02162		475	triacylglycerol lipase	100.0
PLN00413		479	triacylglycerol lipase	100.0
PLN02310		405	triacylglycerol lipase	99.97
cd00519		229	Lipase_3 Lipase (class 3). Lipases are esterases t	99.97
PLN02454		414	triacylglycerol lipase	99.96
PLN02408		365	phospholipase A1	99.96
PLN02324		415	triacylglycerol lipase	99.96
PLN02802		509	triacylglycerol lipase	99.96
PLN02719		518	triacylglycerol lipase	99.96
PLN03037		525	lipase class 3 family protein; Provisional	99.96
PLN02753		531	triacylglycerol lipase	99.96
PLN02761		527	lipase class 3 family protein	99.95
PLN02571		413	triacylglycerol lipase	99.95
PF01764		140	Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr	99.95
PLN02847		633	triacylglycerol lipase	99.93
KOG4569		336	consensus Predicted lipase [Lipid transport and me	99.92
cd00741		153	Lipase Lipase. Lipases are esterases that can hydr	99.71
PF11187		224	DUF2974: Protein of unknown function (DUF2974); In	99.29
KOG4540		425	consensus Putative lipase essential for disintegra	98.77
COG5153		425	CVT17 Putative lipase essential for disintegration	98.77
COG3675		332	Predicted lipase [Lipid metabolism]	98.36
KOG2088		596	consensus Predicted lipase/calmodulin-binding heat	98.05
KOG2088		596	consensus Predicted lipase/calmodulin-binding heat	97.9
COG3675		332	Predicted lipase [Lipid metabolism]	97.85
PF06259		177	Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR	95.9
PF07819		225	PGAP1: PGAP1-like protein; InterPro: IPR012908 The	95.8
PF05057		217	DUF676: Putative serine esterase (DUF676); InterPr	95.47
PF01083		179	Cutinase: Cutinase; InterPro: IPR000675 Aerial pla	94.67
PLN02847		633	triacylglycerol lipase	94.48
PF00975		229	Thioesterase: Thioesterase domain; InterPro: IPR00	94.46
cd00707		275	Pancreat_lipase_like Pancreatic lipase-like enzyme	94.25
PF12697		228	Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3	93.56
PLN02965		255	Probable pheophorbidase	93.48
COG2267		298	PldB Lysophospholipase [Lipid metabolism]	92.98
TIGR01607		332	PST-A Plasmodium subtelomeric family (PST-A). Thes	92.76
PF00561		230	Abhydrolase_1: alpha/beta hydrolase fold A web pag	92.72
KOG2564		343	consensus Predicted acetyltransferases and hydrola	92.65
PLN02298		330	hydrolase, alpha/beta fold family protein	92.21
TIGR02427		251	protocat_pcaD 3-oxoadipate enol-lactonase. Members	92.0
PHA02857		276	monoglyceride lipase; Provisional	92.0
PLN02824		294	hydrolase, alpha/beta fold family protein	91.93
PRK11126		242	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl	91.76
PLN02211		273	methyl indole-3-acetate methyltransferase	91.51
COG3208		244	GrsT Predicted thioesterase involved in non-riboso	91.05
TIGR03695		251	menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene	91.02
PLN02733		440	phosphatidylcholine-sterol O-acyltransferase	90.98
PRK10749		330	lysophospholipase L2; Provisional	90.86
PF11288		207	DUF3089: Protein of unknown function (DUF3089); In	90.82
PRK10673		255	acyl-CoA esterase; Provisional	90.81
PRK10985		324	putative hydrolase; Provisional	90.58
PRK10566		249	esterase; Provisional	90.56
PLN02385		349	hydrolase; alpha/beta fold family protein	90.23
TIGR03056		278	bchO_mg_che_rel putative magnesium chelatase acces	90.11
TIGR03611		257	RutD pyrimidine utilization protein D. This protei	90.09
TIGR01250		288	pro_imino_pep_2 proline-specific peptidases, Bacil	89.84
KOG3724		973	consensus Negative regulator of COPII vesicle form	89.79
TIGR02240		276	PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer	89.72
TIGR03343		282	biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die	89.55
PRK11071		190	esterase YqiA; Provisional	89.35
KOG1455		313	consensus Lysophospholipase [Lipid transport and m	89.33
TIGR01838		532	PHA_synth_I poly(R)-hydroxyalkanoic acid synthase,	88.7
TIGR01836		350	PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth	88.62
PF02450		389	LCAT: Lecithin:cholesterol acyltransferase; InterP	88.5
PLN02511		388	hydrolase	88.32
PRK00870		302	haloalkane dehalogenase; Provisional	88.31
PF12695		145	Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3	88.05
PRK03592		295	haloalkane dehalogenase; Provisional	87.97
COG3319		257	Thioesterase domains of type I polyketide synthase	87.7
TIGR03230		442	lipo_lipase lipoprotein lipase. Members of this pr	87.61
PRK14875		371	acetoin dehydrogenase E2 subunit dihydrolipoyllysi	87.58
PRK08775		343	homoserine O-acetyltransferase; Provisional	87.35
PLN02894		402	hydrolase, alpha/beta fold family protein	86.76
TIGR01840		212	esterase_phb esterase, PHB depolymerase family. Th	86.6
PF05277		345	DUF726: Protein of unknown function (DUF726); Inte	86.53
TIGR03101		266	hydr2_PEP hydrolase, ortholog 2, exosortase system	86.43
TIGR01392		351	homoserO_Ac_trn homoserine O-acetyltransferase. Th	86.21
PRK03204		286	haloalkane dehalogenase; Provisional	85.64
TIGR02821		275	fghA_ester_D S-formylglutathione hydrolase. This m	85.63
PF05728		187	UPF0227: Uncharacterised protein family (UPF0227);	85.43
PF00151		331	Lipase: Lipase; InterPro: IPR013818 Triglyceride l	85.09
PRK10162		318	acetyl esterase; Provisional	85.08
TIGR01738		245	bioH putative pimeloyl-BioC--CoA transferase BioH.	85.01
PRK06489		360	hypothetical protein; Provisional	84.55
PF07859		211	Abhydrolase_3: alpha/beta hydrolase fold A web pag	84.22
PRK11460		232	putative hydrolase; Provisional	83.87
PLN02679		360	hydrolase, alpha/beta fold family protein	83.75
KOG4627		270	consensus Kynurenine formamidase [Amino acid trans	83.73
PLN02442		283	S-formylglutathione hydrolase	83.66
TIGR01249		306	pro_imino_pep_1 proline iminopeptidase, Neisseria-	83.33
PRK10349		256	carboxylesterase BioH; Provisional	83.13
PLN03087		481	BODYGUARD 1 domain containing hydrolase; Provision	82.75
PF06028		255	DUF915: Alpha/beta hydrolase of unknown function (	82.61
PLN00021		313	chlorophyllase	82.54
PRK05855		582	short chain dehydrogenase; Validated	82.5
PF00326		213	Peptidase_S9: Prolyl oligopeptidase family This fa	82.49
TIGR03100		274	hydr1_PEP hydrolase, ortholog 1, exosortase system	82.35
PRK05077		414	frsA fermentation/respiration switch protein; Revi	82.15
PLN02652		395	hydrolase; alpha/beta fold family protein	81.83
PRK13604		307	luxD acyl transferase; Provisional	81.77
COG4782		377	Uncharacterized protein conserved in bacteria [Fun	81.32
PRK00175		379	metX homoserine O-acetyltransferase; Provisional	80.93
smart00824		212	PKS_TE Thioesterase. Peptide synthetases are invol	80.45
PF05990		233	DUF900: Alpha/beta hydrolase of unknown function (	80.33

>PLN02934 triacylglycerol lipase	Back alignment and domain information

Probab=100.00  E-value=2.9e-35  Score=324.07  Aligned_cols=230  Identities=23%  Similarity=0.301  Sum_probs=170.7

Q ss_pred             CceeEEEEcCCC--ceEEEEEccCC--CHHHHHHhcCCccccccCCceeEcccHHHHHHH--------------------
Q 036393          370 PCEWFVCDDFRT--YTRCFVIQGSD--SLASWQANLFFEPTEFEGTDVLVHRGIYEAAKG--------------------  425 (692)
Q Consensus       370 pceffVa~D~~~--ktIVIAFRGT~--Sl~DWltDL~~~~~~~~g~~~~VH~GF~~Aa~~--------------------  425 (692)
                      ..+.||+.|...  +.||||||||.  ++.||++|+++.+.++++ .|+||.||++|+..                    
T Consensus       207 ~TqaFi~~Dk~~d~~~IVVAFRGT~p~s~~dWiTDldfs~~~~p~-~gkVH~GF~~A~~l~~~~~~~tf~~~l~~~~~~~  285 (515)
T PLN02934        207 STQVFIFCDKPKDANLIVISFRGTEPFDADDWGTDFDYSWYEIPK-VGKVHMGFLEAMGLGNRDDTTTFQTSLQTKATSE  285 (515)
T ss_pred             CceEEEEEccccCCceEEEEECCCCcCCHHHHhhccCccccCCCC-CCeecHHHHHHHhhhccccccchhhhhhhccccc
Confidence            345788888754  89999999997  799999999999988764 47999999998841                    


Q ss_pred             -----------------HHHHHHHHHHHHHHhcCCCCeEEEeccchhhHHHHHHHHHHHhcCCCC-CCCcccEEEeCCCc
Q 036393          426 -----------------IYEQFMPEIMDHLNRHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVK-PSTLRPIVTFGSPF  487 (692)
Q Consensus       426 -----------------i~~qll~~L~~lL~~~~p~~kLvVTGHSLGGALAtLlAl~L~~~~~~~-p~~~v~vyTFGsPR  487 (692)
                                       .|.++.+.|+++++++ |+++|+|||||||||||+|+++.|......+ ..+.+.|||||+||
T Consensus       286 ~~~~~~~~~~~~~~~~~Ay~~v~~~lk~ll~~~-p~~kIvVTGHSLGGALAtLaA~~L~l~~~~~~l~~~~~vYTFGsPR  364 (515)
T PLN02934        286 LKEEESKKNLLEMVERSAYYAVRSKLKSLLKEH-KNAKFVVTGHSLGGALAILFPTVLVLQEETEVMKRLLGVYTFGQPR  364 (515)
T ss_pred             cccccccccccccchhhHHHHHHHHHHHHHHHC-CCCeEEEeccccHHHHHHHHHHHHHHhcccccccCceEEEEeCCCC
Confidence                             2345777788877774 6899999999999999999998887654321 12346799999999


Q ss_pred             cccCchHHHHHcC----CCCCcEEEEEECCCcccccCCCCCChHHHHHHHhhcCCCCCCCCCCCCCccccccCcEEEe--
Q 036393          488 VFCGGQKLLNYLG----LDENHVHCVMMHRDIVPRAFSCSYPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFIL--  561 (692)
Q Consensus       488 V~~Gn~~fa~~l~----l~~~~i~RVVn~~DiVPRLP~c~~P~~v~~LLk~l~g~F~~~pCL~~~~~~Y~h~G~~lil--  561 (692)
                      |  ||..|++.+.    .+...++||||.+|+|||||+...+                        ..|.|.|.+++.  
T Consensus       365 V--GN~~FA~~~~~~~~~~~~~~~RVVn~~DiVPrLP~~~~~------------------------~gY~H~G~ev~y~s  418 (515)
T PLN02934        365 I--GNRQLGKFMEAQLNYPVPRYFRVVYCNDLVPRLPYDDKT------------------------FLYKHFGVCLYYDS  418 (515)
T ss_pred             c--cCHHHHHHHHHhhcCCCccEEEEEECCCcccccCCCCCC------------------------cceEeCCeeEEEcC
Confidence            9  9999988653    2335689999999999999864321                        146666666543  


Q ss_pred             ---------cCCCCCC-CCCCccCCCCEEEEEecCCCCCchhhhhhhhcCCCccCccCCC--cccccccCccCCCChHHH
Q 036393          562 ---------QPDEKLS-PSHPLLPPGNALYVLDKMKCGYSTSALRFFLNWPHPLATLSDP--TAYGSDGTILRDHDSSNY  629 (692)
Q Consensus       562 ---------qpd~~~S-p~~pLlPpG~~LylV~~~~~~~s~s~~r~f~n~p~y~e~wsd~--~afGl~~~ml~DH~P~~Y  629 (692)
                               +|+++.. +.+.+..-.+++|.+-+       +++..+.++++|.|.|...  +..|+..|++..|.|.+|
T Consensus       419 ~y~~~~~~eep~~n~f~~~~~i~~~~~a~wel~r-------s~~~~~~~g~~y~e~w~~~~~r~~gl~~pg~~~h~p~dy  491 (515)
T PLN02934        419 RYFGQKMDEEPDRNPFGLRNAISAHLNAVWELWR-------SFIMGYTHGPEYKEGWFSIFFRIMGLVLPGVAAHSPTDY  491 (515)
T ss_pred             CCccccccccCCCCcccHHHHHHHHHHHHHHHHH-------HheeecccCcccchhHHHHHHHHHHHhcCCCccCCcchh
Confidence                     3333322 11112122333443333       3556778999999999665  889999999999999999


Q ss_pred             HHHHH
Q 036393          630 LKAVH  634 (692)
Q Consensus       630 ~~aL~  634 (692)
                      +++++
T Consensus       492 vn~~r  496 (515)
T PLN02934        492 VNSVR  496 (515)
T ss_pred             hccee
Confidence            98875

>PLN02162 triacylglycerol lipase	Back alignment and domain information

>PLN00413 triacylglycerol lipase	Back alignment and domain information

>PLN02310 triacylglycerol lipase	Back alignment and domain information

>cd00519 Lipase_3 Lipase (class 3)	Back alignment and domain information

>PLN02454 triacylglycerol lipase	Back alignment and domain information

>PLN02408 phospholipase A1	Back alignment and domain information

>PLN02324 triacylglycerol lipase	Back alignment and domain information

>PLN02802 triacylglycerol lipase	Back alignment and domain information

>PLN02719 triacylglycerol lipase	Back alignment and domain information

>PLN03037 lipase class 3 family protein; Provisional	Back alignment and domain information

>PLN02753 triacylglycerol lipase	Back alignment and domain information

>PLN02761 lipase class 3 family protein	Back alignment and domain information

>PLN02571 triacylglycerol lipase	Back alignment and domain information

>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides []	Back alignment and domain information

>PLN02847 triacylglycerol lipase	Back alignment and domain information

>KOG4569 consensus Predicted lipase [Lipid transport and metabolism]	Back alignment and domain information

>cd00741 Lipase Lipase	Back alignment and domain information

>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function	Back alignment and domain information

>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism]	Back alignment and domain information

>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism]	Back alignment and domain information

>COG3675 Predicted lipase [Lipid metabolism]	Back alignment and domain information

>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>COG3675 Predicted lipase [Lipid metabolism]	Back alignment and domain information

>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria	Back alignment and domain information

>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT)	Back alignment and domain information

>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases	Back alignment and domain information

>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids []	Back alignment and domain information

>PLN02847 triacylglycerol lipase	Back alignment and domain information

>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []	Back alignment and domain information

>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes	Back alignment and domain information

>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A	Back alignment and domain information

>PLN02965 Probable pheophorbidase	Back alignment and domain information

>COG2267 PldB Lysophospholipase [Lipid metabolism]	Back alignment and domain information

>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A)	Back alignment and domain information

>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PLN02298 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase	Back alignment and domain information

>PHA02857 monoglyceride lipase; Provisional	Back alignment and domain information

>PLN02824 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional	Back alignment and domain information

>PLN02211 methyl indole-3-acetate methyltransferase	Back alignment and domain information

>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase	Back alignment and domain information

>PLN02733 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>PRK10749 lysophospholipase L2; Provisional	Back alignment and domain information

>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function	Back alignment and domain information

>PRK10673 acyl-CoA esterase; Provisional	Back alignment and domain information

>PRK10985 putative hydrolase; Provisional	Back alignment and domain information

>PRK10566 esterase; Provisional	Back alignment and domain information

>PLN02385 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein	Back alignment and domain information

>TIGR03611 RutD pyrimidine utilization protein D	Back alignment and domain information

>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily	Back alignment and domain information

>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase	Back alignment and domain information

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	Back alignment and domain information

>PRK11071 esterase YqiA; Provisional	Back alignment and domain information

>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]	Back alignment and domain information

>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I	Back alignment and domain information

>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit	Back alignment and domain information

>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2	Back alignment and domain information

>PLN02511 hydrolase	Back alignment and domain information

>PRK00870 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A	Back alignment and domain information

>PRK03592 haloalkane dehalogenase; Provisional	Back alignment and domain information

>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03230 lipo_lipase lipoprotein lipase	Back alignment and domain information

>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>PRK08775 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PLN02894 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>TIGR01840 esterase_phb esterase, PHB depolymerase family	Back alignment and domain information

>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins	Back alignment and domain information

>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated	Back alignment and domain information

>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase	Back alignment and domain information

>PRK03204 haloalkane dehalogenase; Provisional	Back alignment and domain information

>TIGR02821 fghA_ester_D S-formylglutathione hydrolase	Back alignment and domain information

>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO	Back alignment and domain information

>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3	Back alignment and domain information

>PRK10162 acetyl esterase; Provisional	Back alignment and domain information

>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH	Back alignment and domain information

>PRK06489 hypothetical protein; Provisional	Back alignment and domain information

>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PRK11460 putative hydrolase; Provisional	Back alignment and domain information

>PLN02679 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02442 S-formylglutathione hydrolase	Back alignment and domain information

>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily	Back alignment and domain information

>PRK10349 carboxylesterase BioH; Provisional	Back alignment and domain information

>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional	Back alignment and domain information

>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>PLN00021 chlorophyllase	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification	Back alignment and domain information

>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated	Back alignment and domain information

>PRK05077 frsA fermentation/respiration switch protein; Reviewed	Back alignment and domain information

>PLN02652 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>PRK13604 luxD acyl transferase; Provisional	Back alignment and domain information

>COG4782 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK00175 metX homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>smart00824 PKS_TE Thioesterase	Back alignment and domain information

>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		692
1tgl_A		269	Triacyl-glycerol acylhydrolase; carboxylic esteras	1e-24
1lgy_A		269	Lipase, triacylglycerol lipase; hydrolase (carboxy	1e-21
1tia_A		279	Lipase; hydrolase(carboxylic esterase); 2.10A {Pen	6e-20
1tib_A		269	Lipase; hydrolase(carboxylic esterase); 1.84A {The	5e-19
3g7n_A		258	Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A	1e-18
3ngm_A		319	Extracellular lipase; secret lipase, hydrolase; 2.	1e-17
1uwc_A		261	Feruloyl esterase A; hydrolase, serine esterase, x	3e-17
2yij_A		419	Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid	5e-16
3uue_A		279	LIP1, secretory lipase (family 3); LID-domain, hyd	8e-16
3o0d_A		301	YALI0A20350P, triacylglycerol lipase; alpha/beta-h	2e-15
2ory_A		346	Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph	8e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-07
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	4e-05

>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269	Back alignment and structure

 Score =  103 bits (258), Expect = 1e-24
 Identities = 44/185 (23%), Positives = 75/185 (40%), Gaps = 6/185 (3%)

Query: 337 AAYVAASTMTAVVAAGEKEKQEAAKDLQSLHS--SPCEWFVCDDFRTYTRCFVIQGSDSL 394
            +Y       A       +  E  K +++  +        V       T   V +GS S+
Sbjct: 26  NSYCRTVIPGATWDCIHCDATEDLKIIKTWSTLIYDTNAMVARGDSEKTIYIVFRGSSSI 85

Query: 395 ASWQANLFFEPTEFEG-TDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQFTGHS 453
            +W A+L F P  +   +   VH+G  ++   +  + +  ++D   ++    K+  TGHS
Sbjct: 86  RNWIADLTFVPVSYPPVSGTKVHKGFLDSYGEVQNELVATVLDQFKQYPS-YKVAVTGHS 144

Query: 454 LGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHR 513
           LGG+ +LL +L L  +     S+   + T G P V  G     NY+          +  R
Sbjct: 145 LGGATALLCALDLYQREEGLSSSNLFLYTQGQPRV--GNPAFANYVVSTGIPYRRTVNER 202

Query: 514 DIVPR 518
           DIVP 
Sbjct: 203 DIVPH 207

PyMOL of 1tgl

>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269	Back alignment and structure

>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279	Back alignment and structure

>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269	Back alignment and structure

>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258	Back alignment and structure

>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319	Back alignment and structure

>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261	Back alignment and structure

>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Length = 419	Back alignment and structure

>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279	Back alignment and structure

>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301	Back alignment and structure

>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Length = 346	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		692
3g7n_A		258	Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A	99.97
3o0d_A		301	YALI0A20350P, triacylglycerol lipase; alpha/beta-h	99.97
3ngm_A		319	Extracellular lipase; secret lipase, hydrolase; 2.	99.97
1uwc_A		261	Feruloyl esterase A; hydrolase, serine esterase, x	99.97
3uue_A		279	LIP1, secretory lipase (family 3); LID-domain, hyd	99.96
1lgy_A		269	Lipase, triacylglycerol lipase; hydrolase (carboxy	99.96
1tia_A		279	Lipase; hydrolase(carboxylic esterase); 2.10A {Pen	99.96
1tib_A		269	Lipase; hydrolase(carboxylic esterase); 1.84A {The	99.95
2yij_A		419	Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid	99.9
1tgl_A		269	Triacyl-glycerol acylhydrolase; carboxylic esteras	99.94
2ory_A		346	Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph	99.91
2qub_A		615	Extracellular lipase; beta roll, alpha/beta hydrol	97.23
2z8x_A		617	Lipase; beta roll, calcium binding protein, RTX pr	96.06
3u0v_A		239	Lysophospholipase-like protein 1; alpha, beta hydr	95.07
2xmz_A		269	Hydrolase, alpha/beta hydrolase fold family; menaq	94.97
3sty_A		267	Methylketone synthase 1; alpha/beta hydrolase, dec	94.73
3lp5_A		250	Putative cell surface hydrolase; structural genom	94.71
3ils_A		265	PKS, aflatoxin biosynthesis polyketide synthase; A	94.58
3dqz_A		258	Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl	94.56
3bdi_A		207	Uncharacterized protein TA0194; NP_393672.1, predi	94.51
3oos_A		278	Alpha/beta hydrolase family protein; APC67239.0, p	94.42
3ds8_A		254	LIN2722 protein; unkonwn function, structural geno	94.38
3l80_A		292	Putative uncharacterized protein SMU.1393C; alpha/	94.33
2ocg_A		254	Valacyclovir hydrolase; alpha beta hydrolase fold;	94.3
2h1i_A		226	Carboxylesterase; structural genomics, PSI-2, prot	94.29
3c6x_A		257	Hydroxynitrilase; atomic resolution, hydroxynitril	94.27
1pja_A		302	Palmitoyl-protein thioesterase 2 precursor; hydrol	94.25
3bdv_A		191	Uncharacterized protein DUF1234; DUF1234 family pr	94.16
3qmv_A		280	Thioesterase, REDJ; alpha/beta hydrolase fold, hyd	94.12
1mtz_A		293	Proline iminopeptidase; alpha-beta hydrolase, CAP	94.09
1xkl_A		273	SABP2, salicylic acid-binding protein 2; alpha-bet	93.99
2wfl_A		264	Polyneuridine-aldehyde esterase; alkaloid metaboli	93.92
2r8b_A		251	AGR_C_4453P, uncharacterized protein ATU2452; APC6	93.91
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	93.91
3kda_A		301	CFTR inhibitory factor (CIF); alpha/beta hydrolase	93.89
3fsg_A		272	Alpha/beta superfamily hydrolase; PF00561, MCSG, P	93.88
2wue_A		291	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas	93.87
1iup_A		282	META-cleavage product hydrolase; aromatic compound	93.87
3r0v_A		262	Alpha/beta hydrolase fold protein; structural geno	93.86
1hkh_A		279	Gamma lactamase; hydrolase, alpha/beta hydrolase,	93.84
3h04_A		275	Uncharacterized protein; protein with unknown func	93.83
2xua_A		266	PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate	93.82
3fle_A		249	SE_1780 protein; structural genomics, APC61035.1,	93.81
4dnp_A		269	DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu	93.79
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	93.76
1j1i_A		296	META cleavage compound hydrolase; carbazole degrad	93.75
1ehy_A		294	Protein (soluble epoxide hydrolase); alpha/beta hy	93.68
1uxo_A		192	YDEN protein; hydrolase, A/B hydrolase, esterase,	93.63
1ufo_A		238	Hypothetical protein TT1662; alpha-beta fold, hydr	93.63
1auo_A		218	Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl	93.62
2cjp_A		328	Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu	93.58
3b5e_A		223	MLL8374 protein; NP_108484.1, carboxylesterase, st	93.52
1wom_A		271	RSBQ, sigma factor SIGB regulation protein RSBQ; a	93.51
3fla_A		267	RIFR; alpha-beta hydrolase thioesterase, hydrolase	93.5
4fle_A		202	Esterase; structural genomics, PSI-biology, northe	93.46
3u1t_A		309	DMMA haloalkane dehalogenase; alpha/beta-hydrolase	93.43
2qjw_A		176	Uncharacterized protein XCC1541; putative hydrolas	93.42
1brt_A		277	Bromoperoxidase A2; haloperoxidase, oxidoreductase	93.41
2puj_A		286	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola;	93.39
3llc_A		270	Putative hydrolase; structural genomics, joint cen	93.36
4g9e_A		279	AHL-lactonase, alpha/beta hydrolase fold protein;	93.35
3qit_A		286	CURM TE, polyketide synthase; thioesterase, alpha/	93.34
2qvb_A		297	Haloalkane dehalogenase 3; RV2579, alpha-beta hydr	93.32
1q0r_A		298	RDMC, aclacinomycin methylesterase; anthracycline,	93.3
3pe6_A		303	Monoglyceride lipase; alpha-beta hydrolase fold, 2	93.28
1c4x_A		285	BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di	93.28
1mj5_A		302	1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase;	93.27
2psd_A		318	Renilla-luciferin 2-monooxygenase; alpha/beta-hydr	93.25
3v48_A		268	Aminohydrolase, putative aminoacrylate hydrolase R	93.23
3bf7_A		255	Esterase YBFF; thioesterase, helical CAP, hydrolas	93.22
3nwo_A		330	PIP, proline iminopeptidase; structural genomics,	93.15
4f0j_A		315	Probable hydrolytic enzyme; alpha/beta hydrolase f	93.15
3hss_A		293	Putative bromoperoxidase; alpha beta hydrolase, ox	93.15
3d7r_A		326	Esterase; alpha/beta fold, hydrolase; 2.01A {Staph	93.15
1u2e_A		289	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	93.08
2yys_A		286	Proline iminopeptidase-related protein; TTHA1809,	93.06
4fbl_A		281	LIPS lipolytic enzyme; thermostable, structural ge	93.02
3om8_A		266	Probable hydrolase; structural genomics, PSI-2, pr	92.94
1azw_A		313	Proline iminopeptidase; aminopeptidase, serine pro	92.92
3e4d_A		278	Esterase D; S-formylglutathione hydrolase, hydrola	92.92
3r40_A		306	Fluoroacetate dehalogenase; FACD, defluorinase, al	92.91
3c5v_A		316	PME-1, protein phosphatase methylesterase 1; demet	92.9
3i1i_A		377	Homoserine O-acetyltransferase; structural genomic	92.88
1r3d_A		264	Conserved hypothetical protein VC1974; structural	92.86
3ibt_A		264	1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO,	92.84
2wtm_A		251	EST1E; hydrolase; 1.60A {Clostridium proteoclastic	92.82
3i6y_A		280	Esterase APC40077; lipase, structural genomics, PS	92.81
1wm1_A		317	Proline iminopeptidase; complex with inhibitor, hy	92.8
3pfb_A		270	Cinnamoyl esterase; alpha/beta hydrolase fold, hyd	92.79
2pl5_A		366	Homoserine O-acetyltransferase; alpha/beta hydrola	92.77
2dst_A		131	Hypothetical protein TTHA1544; conserved hypotheti	92.75
3bwx_A		285	Alpha/beta hydrolase; YP_496220.1, joint center fo	92.75
2fuk_A		220	XC6422 protein; A/B hydrolase, structural genomics	92.74
3rm3_A		270	MGLP, thermostable monoacylglycerol lipase; alpha/	92.73
1gpl_A		432	RP2 lipase; serine esterase, hydrolase, lipid degr	92.69
3hju_A		342	Monoglyceride lipase; alpha/beta hydrolase, hydrol	92.67
3cn9_A		226	Carboxylesterase; alpha/beta hydrolase fold super-	92.64
1fj2_A		232	Protein (acyl protein thioesterase 1); alpha/beta	92.6
3e0x_A		245	Lipase-esterase related protein; APC60309, clostri	92.55
1vkh_A		273	Putative serine hydrolase; structural genomics, jo	92.51
2qmq_A		286	Protein NDRG2, protein NDR2; alpha/beta-hydrolases	92.46
1a8q_A		274	Bromoperoxidase A1; haloperoxidase, oxidoreductase	92.46
3og9_A		209	Protein YAHD A copper inducible hydrolase; alpha/b	92.4
3ia2_A		271	Arylesterase; alpha-beta hydrolase fold, transitio	92.4
2b61_A		377	Homoserine O-acetyltransferase; acyl-enzyme, aspar	92.38
3tjm_A		283	Fatty acid synthase; thioesterase domain, fatty ac	92.37
3ls2_A		280	S-formylglutathione hydrolase; psychrophilic organ	92.35
1a8s_A		273	Chloroperoxidase F; haloperoxidase, oxidoreductase	92.32
3fob_A		281	Bromoperoxidase; structural genomics, IDP00046, ba	92.27
1a88_A		275	Chloroperoxidase L; haloperoxidase, oxidoreductase	92.27
1qoz_A		207	AXE, acetyl xylan esterase; hydrolase, xylan degra	92.21
4b6g_A		283	Putative esterase; hydrolase, formaldehyde detoxif	92.2
2xt0_A		297	Haloalkane dehalogenase; hydrolase, alpha-beta hyd	92.17
1zoi_A		276	Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo	92.13
2qs9_A		194	Retinoblastoma-binding protein 9; B5T overexpresse	92.03
3lcr_A		319	Tautomycetin biosynthetic PKS; alpha-beta hydrolas	92.0
1g66_A		207	Acetyl xylan esterase II; serine hydrolase, acetyl	91.97
2qru_A		274	Uncharacterized protein; alpha/beta-hydrolase, str	91.91
1imj_A		210	CIB, CCG1-interacting factor B; alpha/beta hydrola	91.89
3hc7_A		254	Gene 12 protein, GP12; alpha/beta sandwich, cell a	91.88
3dkr_A		251	Esterase D; alpha beta hydrolase, mechanism, catal	91.87
2wj6_A		276	1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid	91.84
3g9x_A		299	Haloalkane dehalogenase; alpha/beta hydrolase, hel	91.8
1ex9_A		285	Lactonizing lipase; alpha-beta hydrolase fold, pho	91.74
2x5x_A		342	PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE	91.67
3k6k_A		322	Esterase/lipase; alpha/beta hydrolase fold; 2.20A	91.64
2r11_A		306	Carboxylesterase NP; 2632844, putative hydrolase,	91.61
2y6u_A		398	Peroxisomal membrane protein LPX1; hydrolase, puta	91.52
3icv_A		316	Lipase B, CALB; circular permutation, cleavage on	91.51
3p2m_A		330	Possible hydrolase; alpha/beta hydrolase superfami	91.42
3fak_A		322	Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc	91.38
1ycd_A		243	Hypothetical 27.3 kDa protein in AAP1-SMF2 interge	91.17
1w52_X		452	Pancreatic lipase related protein 2; detergent, cl	91.11
3trd_A		208	Alpha/beta hydrolase; cellular processes; 1.50A {C	91.08
3afi_E		316	Haloalkane dehalogenase; A/B-hydrolase, hydrolase;	91.07
3tej_A		329	Enterobactin synthase component F; nonribosomal pe	91.05
2i3d_A		249	AGR_C_3351P, hypothetical protein ATU1826; structu	91.03
2uz0_A		263	Esterase, tributyrin esterase; alpha/beta hydrolas	91.02
4fhz_A		285	Phospholipase/carboxylesterase; alpha/beta hydrola	90.99
1jkm_A		361	Brefeldin A esterase; serine hydrolase, degradatio	90.97
2vat_A		444	Acetyl-COA--deacetylcephalosporin C acetyltransfer	90.95
1m33_A		258	BIOH protein; alpha-betta-alpha sandwich, structur	90.91
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	90.9
1zi8_A		236	Carboxymethylenebutenolidase; alpha and beta prote	90.87
2o2g_A		223	Dienelactone hydrolase; YP_324580.1, structural ge	90.84
1bu8_A		452	Protein (pancreatic lipase related protein 2); hyd	90.77
1tca_A		317	Lipase; hydrolase(carboxylic esterase); HET: NAG;	90.71
1k8q_A		377	Triacylglycerol lipase, gastric; APHA beta hydrola	90.7
1ys1_X		320	Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h	90.63
1jmk_C		230	SRFTE, surfactin synthetase; thioesterase, non-rib	90.63
3qyj_A		291	ALR0039 protein; alpha/beta fold, hydrolase; 1.78A	90.48
3f67_A		241	Putative dienelactone hydrolase; alpha-beta-alpha	90.43
3kxp_A		314	Alpha-(N-acetylaminomethylene)succinic acid hydrol	90.36
2e3j_A		356	Epoxide hydrolase EPHB; epoxide hydrolase B, struc	90.17
3fcx_A		282	FGH, esterase D, S-formylglutathione hydrolase; re	90.11
2pbl_A		262	Putative esterase/lipase/thioesterase; alpha/beta-	90.07
1tqh_A		247	Carboxylesterase precursor; tetrahedral intermedia	90.07
3b12_A		304	Fluoroacetate dehalogenase; dehalogease, hydrolase	89.51
1kez_A		300	Erythronolide synthase; polyketide synthase, modul	90.0
2c7b_A		311	Carboxylesterase, ESTE1; carboxyesterase, thermoph	89.85
1b6g_A		310	Haloalkane dehalogenase; hydrolase, alpha/beta-hyd	89.47
2cb9_A		244	Fengycin synthetase; thioesterase, non-ribosomal p	89.46
1jjf_A		268	Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x	89.43
2hih_A		431	Lipase 46 kDa form; A1 phospholipase, phospholipid	89.1
2k2q_B		242	Surfactin synthetase thioesterase subunit; A/B-hyd	89.04
1ei9_A		279	Palmitoyl protein thioesterase 1; alpha/beta hydro	88.88
3n2z_B		446	Lysosomal Pro-X carboxypeptidase; alpha/beta hydro	88.63
2q0x_A		335	Protein DUF1749, uncharacterized protein; alpha/be	88.58
2rau_A		354	Putative esterase; NP_343859.1, putative lipase, s	88.58
1l7a_A		318	Cephalosporin C deacetylase; structural genomics,	88.57
1jji_A		311	Carboxylesterase; alpha-beta hydrolase fold, hydro	88.36
1hpl_A		449	Lipase; hydrolase(carboxylic esterase); 2.30A {Equ	88.23
3d0k_A		304	Putative poly(3-hydroxybutyrate) depolymerase LPQ;	88.07
2hfk_A		319	Pikromycin, type I polyketide synthase pikaiv; alp	88.07
3vdx_A		456	Designed 16NM tetrahedral protein CAGE containing	87.83
4e15_A		303	Kynurenine formamidase; alpha/beta hydrolase fold,	87.83
2px6_A		316	Thioesterase domain; thioesaterse domain, orlistat	87.82
3ain_A		323	303AA long hypothetical esterase; carboxylesterase	87.75
3doh_A		380	Esterase; alpha-beta hydrolase, beta sheet; 2.60A	87.5
1dqz_A		280	85C, protein (antigen 85-C); fibronectin, structur	87.39
1lzl_A		323	Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod	87.21
3h2g_A		397	Esterase; xanthomonas oryzae PV. oryzae, cell WALL	87.04
1vlq_A		337	Acetyl xylan esterase; TM0077, structural genomics	87.02
2zyr_A		484	Lipase, putative; fatty acid, hydrolase; HET: 1PE;	86.92
2hm7_A		310	Carboxylesterase; alpha/beta hydrolase fold, hydro	86.8
4h0c_A		210	Phospholipase/carboxylesterase; PSI-biology, midwe	86.78
3bjr_A		283	Putative carboxylesterase; structural genomics, jo	86.43
2zsh_A		351	Probable gibberellin receptor GID1L1; plant hormon	86.38
1rp1_A		450	Pancreatic lipase related protein 1; hydrolase, li	86.3
2wir_A		313	Pesta, alpha/beta hydrolase fold-3 domain protein;	86.2
1r88_A		280	MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP	86.14
3ksr_A		290	Putative serine hydrolase; catalytic triad, struct	86.07
3ga7_A		326	Acetyl esterase; phosphoserine, IDP00896, hydrolas	85.97
2qm0_A		275	BES; alpha-beta structure, structural genomics, PS	85.89
3bxp_A		277	Putative lipase/esterase; putative carboxylesteras	85.79
1tht_A		305	Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.	85.61
2dsn_A		387	Thermostable lipase; T1 lipase, hydrolase; 1.50A {	85.45
3qh4_A		317	Esterase LIPW; structural genomics, ssgcid, seattl	85.44
3hxk_A		276	Sugar hydrolase; alpha-beta protein., structural g	85.41
3fcy_A		346	Xylan esterase 1; alpha/beta hydrolase, carbohydra	85.32
3aja_A		302	Putative uncharacterized protein; alpha-beta hydro	85.24
3g02_A		408	Epoxide hydrolase; alpha/beta hydrolase fold, enan	85.06
1sfr_A		304	Antigen 85-A; alpha/beta hydrolase, structural gen	84.81
3mve_A		415	FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/	84.49
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	84.38
4i19_A		388	Epoxide hydrolase; structural genomics, PSI-biolog	83.94
4ezi_A		377	Uncharacterized protein; alpha-beta hydrolases fol	83.63
1qlw_A		328	Esterase; anisotropic refinement, atomic resolutio	83.53
3ebl_A		365	Gibberellin receptor GID1; alpha/beta hydrolase, l	83.53
3qpa_A		197	Cutinase; alpha-beta hydrolase fold, esterase, hyd	83.22
2o7r_A		338	CXE carboxylesterase; alpha/beta hydrolase; 1.40A	82.86
1gkl_A		297	Endo-1,4-beta-xylanase Y; hydrolase, esterase fami	82.66
1jfr_A		262	Lipase; serine hydrolase; 1.90A {Streptomyces exfo	82.56
2fx5_A		258	Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse	81.95
3k2i_A		422	Acyl-coenzyme A thioesterase 4; alpha/beta hydrola	81.72
2hdw_A		367	Hypothetical protein PA2218; alpha/beta hydrolase	81.36
3hlk_A		446	Acyl-coenzyme A thioesterase 2, mitochondrial; alp	80.67

>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum}	Back alignment and structure

Probab=99.97  E-value=1.6e-31  Score=274.04  Aligned_cols=162  Identities=17%  Similarity=0.223  Sum_probs=135.7

Q ss_pred             CceeEEEEcCCCceEEEEEccCCCHHHHHHhcCCcccccc------CCceeEcccHHHHHHHHHHHHHHHHHHHHHhcCC
Q 036393          370 PCEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFE------GTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGE  443 (692)
Q Consensus       370 pceffVa~D~~~ktIVIAFRGT~Sl~DWltDL~~~~~~~~------g~~~~VH~GF~~Aa~~i~~qll~~L~~lL~~~~p  443 (692)
                      .+.+||+.|++++.|||+||||.++.||++|+.+.++++.      +.+++||+||++++..+++++.+.|+++++++ |
T Consensus        44 d~~gyva~d~~~~~IvVafRGT~s~~dw~~Dl~~~~~~~~~~g~~~~~~~~VH~GF~~~~~~~~~~~~~~l~~~~~~~-p  122 (258)
T 3g7n_A           44 DTNGFVGYSTEKKTIAVIMRGSTTITDFVNDIDIALITPELSGVTFPSDVKIMRGVHRPWSAVHDTIITEVKALIAKY-P  122 (258)
T ss_dssp             TEEEEEEEETTTTEEEEEECCCSCCCC----CCCCEECCCCTTCCCCTTCCEEHHHHHHHHHHHHHHHHHHHHHHHHS-T
T ss_pred             CceEEEEEECCCCEEEEEECCCCCHHHHHHhcccceeccccCCCcCCCCcEEehhHHHHHHHHHHHHHHHHHHHHHhC-C
Confidence            3568999999999999999999999999999999887642      26889999999999999999999999988775 6


Q ss_pred             CCeEEEeccchhhHHHHHHHHHHHhcCCCCCCCcccEEEeCCCccccCchHHHHHcCCCCCcEEEEEECCCcccccCCCC
Q 036393          444 RAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCS  523 (692)
Q Consensus       444 ~~kLvVTGHSLGGALAtLlAl~L~~~~~~~p~~~v~vyTFGsPRV~~Gn~~fa~~l~l~~~~i~RVVn~~DiVPRLP~c~  523 (692)
                      +++|+|||||||||||+|++++|....+   ...+.+||||+|||  ||..|++.++.....++||||.+|+||+||+. 
T Consensus       123 ~~~i~vtGHSLGGalA~l~a~~l~~~~~---~~~v~~~tFg~Prv--Gn~~fa~~~~~~~~~~~Rvvn~~D~VP~lPp~-  196 (258)
T 3g7n_A          123 DYTLEAVGHSLGGALTSIAHVALAQNFP---DKSLVSNALNAFPI--GNQAWADFGTAQAGTFNRGNNVLDGVPNMYSS-  196 (258)
T ss_dssp             TCEEEEEEETHHHHHHHHHHHHHHHHCT---TSCEEEEEESCCCC--BCHHHHHHHHHSSSEEEEEEETTCBGGGTTCS-
T ss_pred             CCeEEEeccCHHHHHHHHHHHHHHHhCC---CCceeEEEecCCCC--CCHHHHHHHHhcCCCeEEEEeCCCccCcCCCC-
Confidence            8999999999999999999999988753   34578999999999  99999987753346789999999999999851 


Q ss_pred             CChHHHHHHHhhcCCCCCCCCCCCCCccccccCcEEEec
Q 036393          524 YPNHVALVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQ  562 (692)
Q Consensus       524 ~P~~v~~LLk~l~g~F~~~pCL~~~~~~Y~h~G~~lilq  562 (692)
                       +                       ..+|.|+|.+++..
T Consensus       197 -~-----------------------~~gy~H~g~e~~~~  211 (258)
T 3g7n_A          197 -P-----------------------LVNFKHYGTEYYSS  211 (258)
T ss_dssp             -T-----------------------TTCCBCCSEEEEES
T ss_pred             -C-----------------------CcCCEecceEEEEC
Confidence             1                       12699999999753

PyMOL of 3g7n

>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0	Back alignment and structure

>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae}	Back alignment and structure

>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A*	Back alignment and structure

>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A*	Back alignment and structure

>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A	Back alignment and structure

>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17	Back alignment and structure

>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A*	Back alignment and structure

>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A	Back alignment and structure

>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP}	Back alignment and structure

>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A	Back alignment and structure

>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A	Back alignment and structure

>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens}	Back alignment and structure

>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus}	Back alignment and structure

>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A*	Back alignment and structure

>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum}	Back alignment and structure

>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus}	Back alignment and structure

>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0	Back alignment and structure

>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis}	Back alignment and structure

>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua}	Back alignment and structure

>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A	Back alignment and structure

>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14	Back alignment and structure

>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ...	Back alignment and structure

>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13	Back alignment and structure

>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A*	Back alignment and structure

>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A	Back alignment and structure

>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A*	Back alignment and structure

>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A*	Back alignment and structure

>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica}	Back alignment and structure

>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A	Back alignment and structure

>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni}	Back alignment and structure

>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A	Back alignment and structure

>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A	Back alignment and structure

>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus}	Back alignment and structure

>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A*	Back alignment and structure

>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp}	Back alignment and structure

>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans}	Back alignment and structure

>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis}	Back alignment and structure

>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A	Back alignment and structure

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A	Back alignment and structure

>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10	Back alignment and structure

>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11	Back alignment and structure

>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31	Back alignment and structure

>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27	Back alignment and structure

>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A*	Back alignment and structure

>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A*	Back alignment and structure

>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14	Back alignment and structure

>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A*	Back alignment and structure

>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A*	Back alignment and structure

>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp}	Back alignment and structure

>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified}	Back alignment and structure

>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV}	Back alignment and structure

>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A	Back alignment and structure

>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A	Back alignment and structure

>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis}	Back alignment and structure

>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A	Back alignment and structure

>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L}	Back alignment and structure

>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A	Back alignment and structure

>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A*	Back alignment and structure

>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A*	Back alignment and structure

>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10	Back alignment and structure

>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A	Back alignment and structure

>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A	Back alignment and structure

>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11}	Back alignment and structure

>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A	Back alignment and structure

>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis}	Back alignment and structure

>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa}	Back alignment and structure

>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A	Back alignment and structure

>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp}	Back alignment and structure

>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli}	Back alignment and structure

>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus}	Back alignment and structure

>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A	Back alignment and structure

>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0	Back alignment and structure

>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7	Back alignment and structure

>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0	Back alignment and structure

>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A	Back alignment and structure

>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P	Back alignment and structure

>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str}	Back alignment and structure

>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35	Back alignment and structure

>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida}	Back alignment and structure

>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A*	Back alignment and structure

>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A	Back alignment and structure

>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A*	Back alignment and structure

>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A*	Back alignment and structure

>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40	Back alignment and structure

>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39	Back alignment and structure

>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36	Back alignment and structure

>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A	Back alignment and structure

>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A	Back alignment and structure

>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens}	Back alignment and structure

>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A*	Back alignment and structure

>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14	Back alignment and structure

>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum}	Back alignment and structure

>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32	Back alignment and structure

>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A	Back alignment and structure

>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12	Back alignment and structure

>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0	Back alignment and structure

>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A	Back alignment and structure

>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40	Back alignment and structure

>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A	Back alignment and structure

>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0	Back alignment and structure

>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12	Back alignment and structure

>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0	Back alignment and structure

>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12	Back alignment and structure

>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30	Back alignment and structure

>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58}	Back alignment and structure

>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica}	Back alignment and structure

>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A	Back alignment and structure

>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens}	Back alignment and structure

>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP}	Back alignment and structure

>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A*	Back alignment and structure

>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis}	Back alignment and structure

>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23	Back alignment and structure

>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29}	Back alignment and structure

>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A	Back alignment and structure

>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A*	Back alignment and structure

>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A	Back alignment and structure

>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18	Back alignment and structure

>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A	Back alignment and structure

>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A	Back alignment and structure

>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis}	Back alignment and structure

>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A*	Back alignment and structure

>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A*	Back alignment and structure

>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis}	Back alignment and structure

>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A	Back alignment and structure

>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus}	Back alignment and structure

>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii}	Back alignment and structure

>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A*	Back alignment and structure

>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A	Back alignment and structure

>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36	Back alignment and structure

>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae}	Back alignment and structure

>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A*	Back alignment and structure

>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2	Back alignment and structure

>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A*	Back alignment and structure

>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A*	Back alignment and structure

>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis}	Back alignment and structure

>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A*	Back alignment and structure

>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A*	Back alignment and structure

>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A*	Back alignment and structure

>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E	Back alignment and structure

>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22	Back alignment and structure

>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP}	Back alignment and structure

>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti}	Back alignment and structure

>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A*	Back alignment and structure

>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0	Back alignment and structure

>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2	Back alignment and structure

>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A	Back alignment and structure

>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A	Back alignment and structure

>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A	Back alignment and structure

>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon}	Back alignment and structure

>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A	Back alignment and structure

>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A*	Back alignment and structure

>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A*	Back alignment and structure

>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus}	Back alignment and structure

>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A	Back alignment and structure

>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A	Back alignment and structure

>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens}	Back alignment and structure

>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei}	Back alignment and structure

>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2}	Back alignment and structure

>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B*	Back alignment and structure

>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2	Back alignment and structure

>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19	Back alignment and structure

>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822}	Back alignment and structure

>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A	Back alignment and structure

>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A	Back alignment and structure

>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A	Back alignment and structure

>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens}	Back alignment and structure

>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A	Back alignment and structure

>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A	Back alignment and structure

>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A*	Back alignment and structure

>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A	Back alignment and structure

>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A	Back alignment and structure

>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A*	Back alignment and structure

>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A*	Back alignment and structure

>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A	Back alignment and structure

>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans}	Back alignment and structure

>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A*	Back alignment and structure

>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A	Back alignment and structure

>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3	Back alignment and structure

>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV}	Back alignment and structure

>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium}	Back alignment and structure

>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579}	Back alignment and structure

>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A*	Back alignment and structure

>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13	Back alignment and structure

>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A	Back alignment and structure

>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum}	Back alignment and structure

>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp}	Back alignment and structure

>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP}	Back alignment and structure

>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis}	Back alignment and structure

>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A*	Back alignment and structure

>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3	Back alignment and structure

>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp}	Back alignment and structure

>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp}	Back alignment and structure

>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A*	Back alignment and structure

>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A*	Back alignment and structure

>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ...	Back alignment and structure

>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A	Back alignment and structure

>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A*	Back alignment and structure

>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16	Back alignment and structure

>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina}	Back alignment and structure

>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens}	Back alignment and structure

>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa}	Back alignment and structure

>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		692
d3tgla_		265	c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor	2e-18
d1lgya_		265	c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus ni	5e-15
d1uwca_		261	c.69.1.17 (A:) Feruloyl esterase A {Aspergillus ni	2e-14
d1tiba_		269	c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces	9e-13

>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Length = 265	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Rhizomucor miehei [TaxId: 4839]

 Score = 83.7 bits (206), Expect = 2e-18
 Identities = 40/147 (27%), Positives = 64/147 (43%), Gaps = 4/147 (2%)

Query: 373 WFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFEG-TDVLVHRGIYEAAKGIYEQFM 431
             V       T   V +GS S+ +W A+L F P  +   +   VH+G  ++   +  + +
Sbjct: 60  AMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTKVHKGFLDSYGEVQNELV 119

Query: 432 PEIMDHLNRHGERAKLQFTGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCG 491
             ++D   ++    K+  TGHSLGG+  LL +L L  +     S+   + T G P V  G
Sbjct: 120 ATVLDQFKQYPS-YKVAVTGHSLGGATVLLCALDLYQREEGLSSSNLFLYTQGQPRV--G 176

Query: 492 GQKLLNYLGLDENHVHCVMMHRDIVPR 518
                NY+          +  RDIVP 
Sbjct: 177 DPAFANYVVSTGIPYRRTVNERDIVPH 203

PyMOL of d3tgla_

>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Length = 265	Back information, alignment and structure

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Length = 261	Back information, alignment and structure

>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		692
d3tgla_		265	Triacylglycerol lipase {Rhizomucor miehei [TaxId:	100.0
d1lgya_		265	Triacylglycerol lipase {Rhizopus niveus [TaxId: 48	100.0
d1tiba_		269	Triacylglycerol lipase {Thermomyces lanuginosus, f	100.0
d1uwca_		261	Feruloyl esterase A {Aspergillus niger [TaxId: 506	100.0
d1tiaa_		271	Triacylglycerol lipase {Penicillium camembertii [T	100.0
d1pjaa_		268	Palmitoyl protein thioesterase 2 {Human (Homo sapi	95.48
d1ispa_		179	Lipase A {Bacillus subtilis [TaxId: 1423]}	94.89
d3c70a1		256	Hydroxynitrile lyase {Rubber tree (Hevea brasilien	94.71
d1jmkc_		230	Surfactin synthetase, SrfA {Bacillus subtilis [Tax	94.22
d1mtza_		290	Tricorn interacting factor F1 {Archaeon Thermoplas	94.03
d1xkta_		286	Fatty acid synthase {Human (Homo sapiens) [TaxId:	94.0
d1j1ia_		268	Meta cleavage compound hydrolase CarC {Janthinobac	93.47
d1hkha_		279	Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]	93.39
d1cvla_		319	Lipase {Chromobacterium viscosum [TaxId: 42739]}	93.22
d1brta_		277	Bromoperoxidase A2 {Streptomyces aureofaciens [Tax	93.21
d1ex9a_		285	Lipase {Pseudomonas aeruginosa [TaxId: 287]}	92.46
d1ehya_		293	Bacterial epoxide hydrolase {Agrobacterium radioba	92.37
d2h7xa1		283	Picromycin polyketide synthase {Streptomyces venez	92.15
d1mo2a_		255	Erythromycin polyketide synthase {Saccharopolyspor	91.81
d3b5ea1		209	Uncharacterized protein Mll8374 {Mesorhizobium lot	91.44
d1thta_		302	Myristoyl-ACP-specific thioesterase {Vibrio harvey	91.43
d1c4xa_		281	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	91.39
d1q0ra_		297	Aclacinomycin methylesterase RdmC {Streptomyces pu	91.35
d1uk8a_		271	Meta-cleavage product hydrolase CumD {Pseudomonas	91.25
d1tcaa_		317	Triacylglycerol lipase {Yeast (Candida antarctica)	91.22
d1zd3a2		322	Mammalian epoxide hydrolase, C-terminal domain {Hu	91.0
d1a8qa_		274	Bromoperoxidase A1 {Streptomyces aureofaciens [Tax	90.99
d2rhwa1		283	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	90.82
d2fuka1		218	XC6422 protein {Xanthomonas campestris [TaxId: 339	90.8
d1cexa_		197	Cutinase {Fungus (Fusarium solani), subsp. pisi [T	90.59
d1uxoa_		186	Hypothetical protein YdeN {Bacillus subtilis [TaxI	90.55
d1k8qa_		377	Gastric lipase {Dog (Canis familiaris) [TaxId: 961	90.41
d1mj5a_		298	Haloalkane dehalogenase {Sphingomonas paucimobilis	90.1
d1vkha_		263	Putative serine hydrolase Ydr428c {Baker's yeast (	90.04
d1bn7a_		291	Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1	90.02
d1b6ga_		310	Haloalkane dehalogenase {Xanthobacter autotrophicu	89.47
d1azwa_		313	Proline iminopeptidase {Xanthomonas campestris, pv	89.34
d1xkla_		258	Salicylic acid-binding protein 2 (SABP2) {Common t	88.53
d1r3da_		264	Hypothetical protein VC1974 {Vibrio cholerae [TaxI	88.21
d1imja_		208	Ccg1/TafII250-interacting factor B (Cib) {Human (H	87.17
d2dsta1		122	Hypothetical protein TTHA1544 {Thermus thermophilu	86.91
d1fj2a_		229	Acyl protein thioesterase 1 {Human (Homo sapiens)	86.33
d1rp1a2		337	Pancreatic lipase, N-terminal domain {Dog (Canis f	85.01
d1ei9a_		279	Palmitoyl protein thioesterase 1 {Cow (Bos taurus)	84.2
d1tqha_		242	Carboxylesterase Est {Bacillus stearothermophilus	84.18
d1sfra_		288	Antigen 85a {Mycobacterium tuberculosis [TaxId: 17	81.79
d1va4a_		271	Arylesterase {Pseudomonas fluorescens [TaxId: 294]	81.65
d1bu8a2		338	Pancreatic lipase, N-terminal domain {Rat (Rattus	80.71
d1dqza_		280	Antigen 85c {Mycobacterium tuberculosis [TaxId: 17	80.29
d1a8sa_		273	Chloroperoxidase F {Pseudomonas fluorescens [TaxId	80.21

>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Rhizomucor miehei [TaxId: 4839]

Probab=100.00  E-value=6.9e-34  Score=289.87  Aligned_cols=163  Identities=25%  Similarity=0.374  Sum_probs=142.0

Q ss_pred             ceeEEEEcCCCceEEEEEccCCCHHHHHHhcCCcccccc-CCceeEcccHHHHHHHHHHHHHHHHHHHHHhcCCCCeEEE
Q 036393          371 CEWFVCDDFRTYTRCFVIQGSDSLASWQANLFFEPTEFE-GTDVLVHRGIYEAAKGIYEQFMPEIMDHLNRHGERAKLQF  449 (692)
Q Consensus       371 ceffVa~D~~~ktIVIAFRGT~Sl~DWltDL~~~~~~~~-g~~~~VH~GF~~Aa~~i~~qll~~L~~lL~~~~p~~kLvV  449 (692)
                      ..+||++|+.++.|||+||||.++.||++||++.+++++ ..+++||+||+.++..++.++...|.++++++ ++++|+|
T Consensus        58 ~~~~v~~~~~~~~ivV~fRGT~s~~d~~~dl~~~~~~~~~~~~~~VH~GF~~~~~~v~~~i~~~i~~~~~~~-~~~~i~v  136 (265)
T d3tgla_          58 TNAMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTKVHKGFLDSYGEVQNELVATVLDQFKQY-PSYKVAV  136 (265)
T ss_dssp             CEEEEEEETTTTEEEEEECCCSSHHHHHHHCCCCEEECTTSTTCEEEHHHHHHHHHHHHHHHHHHHHHHHHC-TTSEEEE
T ss_pred             ceEEEEEeCCCCEEEEEEcCCCCHHHHHHhCccccccccCCCCcEEehhHHHHHHHHHHHHHHHHHHHHHhC-CCceEEE
Confidence            358899999999999999999999999999999998876 36789999999999999999999999988875 6899999


Q ss_pred             eccchhhHHHHHHHHHHHhcCCCCCCCcccEEEeCCCccccCchHHHHHcCCCCCcEEEEEECCCcccccCCCCCChHHH
Q 036393          450 TGHSLGGSLSLLVSLMLLNQGIVKPSTLRPIVTFGSPFVFCGGQKLLNYLGLDENHVHCVMMHRDIVPRAFSCSYPNHVA  529 (692)
Q Consensus       450 TGHSLGGALAtLlAl~L~~~~~~~p~~~v~vyTFGsPRV~~Gn~~fa~~l~l~~~~i~RVVn~~DiVPRLP~c~~P~~v~  529 (692)
                      ||||||||||+|++++|..+....+...+.+||||+|||  ||.+|++.+......++||+|.+|+||+||+..      
T Consensus       137 tGHSLGGAlA~L~a~~l~~~~~~~~~~~i~~~TFG~Prv--Gn~~fa~~~~~~~~~~~Rvvn~~D~VP~lP~~~------  208 (265)
T d3tgla_         137 TGHSLGGATVLLCALDLYQREEGLSSSNLFLYTQGQPRV--GDPAFANYVVSTGIPYRRTVNERDIVPHLPPAA------  208 (265)
T ss_dssp             EEETHHHHHHHHHHHHHHHTCSSCCTTTEEEEEESCCCC--BCHHHHHHHHHTCCCEEEEEETTBSGGGCSCGG------
T ss_pred             ecccchHHHHHHHHHHHHHhccccCccccceeecCCCcc--CCHHHHHHHHhcCceEEEEEecCCEEeeCCCCC------
Confidence            999999999999999998776433445678999999999  999999877544456789999999999998521      


Q ss_pred             HHHHhhcCCCCCCCCCCCCCccccccCcEEEec
Q 036393          530 LVLKRLSGTFRSHPCLNKNKLLYSPLGKLFILQ  562 (692)
Q Consensus       530 ~LLk~l~g~F~~~pCL~~~~~~Y~h~G~~lilq  562 (692)
                                          ..|.|+|.+++..
T Consensus       209 --------------------~gy~H~g~e~~~~  221 (265)
T d3tgla_         209 --------------------FGFLHAGEEYWIT  221 (265)
T ss_dssp             --------------------GSCBCBSEEEEEE
T ss_pred             --------------------CCCEecCeEEEEe
Confidence                                2599999999864

PyMOL of d3tgla_

>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]}	Back information, alignment and structure

>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]}	Back information, alignment and structure

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]}	Back information, alignment and structure

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}	Back information, alignment and structure

>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}	Back information, alignment and structure

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}	Back information, alignment and structure

>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}	Back information, alignment and structure

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}	Back information, alignment and structure

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]}	Back information, alignment and structure

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]}	Back information, alignment and structure

>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}	Back information, alignment and structure

>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure