Citrus Sinensis ID: 036401


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150----
MPSLLSPGKIHRLELENFKSYKGLQIIGPFSDFTAIIGPNGAGKSNLMDAISFVLGVRTGQLRGGQLKDLIYAYDDKEKEQKGRRAFVRLVYQLGNESELQFTRTITSSGGSEYRIDGRVVNWDEYNAKLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGSDELKREYEVLEDEKGKAEEKSALVYQKKRTVVLERKQKKEQKEEAERHLRLQDQLKSLKKEHFLWQLFNIEKDITKASKDLEAEKRSREEVMRELEHFEDQKRGKRKELAKYLKEIAQCEKKIAERNNRLDKSQPELLKLNEEMSRINSKIKSSKKELERKREERRKHANDIKELQKGIQDLTGKLEELNEKSRDGAGRLPLLDTQLTEYFQIKEEAGMKTAKLRDEKEVLDREQHADLEVLKNLEANLQQLSNREHELDAQEDQMRKRQKNILDASGGHKDELTKLKKELRSMQDKHRDSRQKYENLKSKIGEIENQLRELKADRHENERDAKLSQAVETLKRLFQGVHGRMTDLCRPTQKKYNLAVTVAMGKFMDAVVVEDENTGKECIKAVLFAVGNTLVCDGLDEAKVLSWSGERFRVVTVDGILLTKAGTMTGGTTGGMEARSKQWDDKKIEGLKRKKEQYESELEELGSIREMQLRESETSGKISGLEKKIQYAEIEKRSIEDKLANLRQEKRTIKEEIGRIKPDLQKLKDKIDRRTTDINKLERRINEITDRLYRDFSESVGVANIREYEENQLKAAQNVAEERLNLSNQLAKLKYQLEYEQKRDVESRIKKLESSLSTLENDLKQVKKKEGDVKSATETATGDITRWKEEMRGWKSNSDECEKEIQEWEKQASAATTSLSKLNRQINSKEAQIEQLISRKQEIMEKCELECIVLPTVEDPMETDSSSPGPVFDFSQLNRSYLQERRPSEREKLEVEFKQKMDALISEIEKTAPNLKALDQYEALLEKERTVTEEFEAARKEEKQAADAYNSVKQKRYGLFMEAFNHISSSIDRIYKQLTRSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYKPSPFFILDEVDAALDNLNVAKVAGFIRSKSCEGTRGNQDADEGNGFQSIVISLKDSFYDKAEALVGVYRDSDRR
cccccccccEEEEEEcccccccccEEEccccccEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEEEEcccccEEEEccccccHHHHHHHHHHccccccccccccccccHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccEEEccHHHHHHHHHHHHHHHccEEEEccHHHHHHHHccccccEEEEEcccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEECcccccccccccEEEECcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccHHHHHccccEEEccccccc
******P*KIHRLELENFKSYKGLQIIGPFSDFTAIIGPNGAGKSNLMDAISFVLGVRTGQLRGGQLKDLIYAYDDKE***KGRRAFVRLVYQLGNESELQFTRTITSSGGSEYRIDGRVVNWDEYNAKLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGSDELKREYEVLEDEKGKAEEKSALVYQKKRTVV***********EAERHLRLQDQLKSLKKEHFLWQLFNIEKDI*******************************************************************************************************************************LLDTQLTEYFQI*****************************************************************************************************************************VETLKRLFQGVHGRMTDLCRPTQKKYNLAVTVAMGKFMDAVVVEDENTGKECIKAVLFAVGNTLVCDGLDEAKVLSWSGERFRVVTVDGILLTKAGTMTG***********************************************************************************************************INKLERRINEITDRLYRDFSESVGVANIREYE**********************KLKY**********************************************************************************************************EIMEKCELECIVLPT***********PGPVFDFSQLNR****************************IEKTAPNLKALDQYEALLEKERTVTEEFEAARKEEKQAADAYNSVKQKRYGLFMEAFNHISSSIDRIYKQLTRSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYKPSPFFILDEVDAALDNLNVAKVAGFIRSKSCEGTRGN**ADEGNGFQSIVISLKDSFYDKAEALVGVYRD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSLLSPGKIHRLELENFKSYKGLQIIGPFSDFTAIIGPNGAGKSNLMDAISFVLGVRTGQLRGGQLKDLIYAYDDKEKEQKGRRAFVRLVYQLGNESELQFTRTITSSGGSEYRIDGRVVNWDEYNAKLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGxxxxxxxxxxxxxxxxxxxxxSALVYQKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHFLWQLFNIEKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDKSQPExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSRDGAGRLPLLDTQLTEYFQIKEEAGMKTAKLRDEKEVLDRExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILDASGGHKDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKLSQAVETLKRLFQGVHGRMTDLCRPTQKKYNLAVTVAMGKFMDAVVVEDENTGKECIKAVLFAVGNTLVCDGLDEAKVLSWSGERFRVVTVDGILLTKAGTMTGGTTGGMEARSKQWDDKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxSETSGKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIGRIKPDxxxxxxxxxxxxxxxxxxxxxxxxxxxxLYRDFSESVGVANxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEYEQxxxxxxxxxxxxxxxxxxxxxxxxxxxxEGDVKSATETATGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCELECIVLPTVEDPMETDSSSPGPVFDFSQLNRSYLQERRPSEREKLEVEFKQKMDALISEIEKTAPNLKAxxxxxxxxxxxxxxxxxxxxxxxxEKQAADAYNSVKQKRYGLFMEAFNHISSSIDRIYKQLTRSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYKPSPFFILDEVDAALDNLNVAKVAGFIRSKSCEGTRGNQDADEGNGFQSIVISLKDSFYDKAEALVGVYRDSDRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Structural maintenance of chromosomes protein 1 Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement (By similarity). Essential protein plant viability. Required for chromosome segregation (e.g. sister chromatid alignment) and cell division during embryogenesis.probableQ6Q1P4
Structural maintenance of chromosomes protein 1A Involved in chromosome cohesion during cell cycle and in DNA repair. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, and works as a downstream effector in the ATM/NBS1 branch of S-phase checkpoint (By similarity). Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, or via its phosphorylation by ATR. Works as a downstream effector both in the ATM/NBS1 branch and in the ATR/MSH2 branch of S-phase checkpoint.probableQ9CU62
Structural maintenance of chromosomes protein 1 Involved in chromosome cohesion during cell cycle and in DNA repair. Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate.probableP32908

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 8-164
View the alignment between query and template
View the model in PyMOL
Template: 1E69, chain A
Confidence level:very confident
Coverage over the Query: 1044-1109,1122-1153
View the alignment between query and template
View the model in PyMOL
Template: 2WD5, chain A
Confidence level:very confident
Coverage over the Query: 504-630
View the alignment between query and template
View the model in PyMOL
Template: 3KTA, chain B
Confidence level:very confident
Coverage over the Query: 992-1109,1122-1153
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:confident
Coverage over the Query: 425-448
View the alignment between query and template
View the model in PyMOL
Template: 3ZGX, chain A
Confidence level:confident
Coverage over the Query: 953-1113,1127-1147
View the alignment between query and template
View the model in PyMOL
Template: 2FXO, chain A
Confidence level:probable
Coverage over the Query: 254-352
View the alignment between query and template
View the model in PyMOL
Template: 3HNW, chain A
Confidence level:probable
Coverage over the Query: 657-721
View the alignment between query and template
View the model in PyMOL
Template: 2B9C, chain A
Confidence level:probable
Coverage over the Query: 306-361,390-464
View the alignment between query and template
View the model in PyMOL
Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 610-1018
View the alignment between query and template
View the model in PyMOL
Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 610-1018
View the alignment between query and template
View the model in PyMOL