Citrus Sinensis ID: 036401
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1154 | 2.2.26 [Sep-21-2011] | |||||||
| Q6Q1P4 | 1218 | Structural maintenance of | yes | no | 0.997 | 0.944 | 0.681 | 0.0 | |
| Q14683 | 1233 | Structural maintenance of | yes | no | 0.963 | 0.901 | 0.351 | 0.0 | |
| Q9CU62 | 1233 | Structural maintenance of | yes | no | 0.960 | 0.898 | 0.352 | 0.0 | |
| O97593 | 1233 | Structural maintenance of | yes | no | 0.960 | 0.898 | 0.352 | 0.0 | |
| Q9Z1M9 | 1233 | Structural maintenance of | yes | no | 0.960 | 0.898 | 0.351 | 0.0 | |
| O93308 | 1232 | Structural maintenance of | N/A | no | 0.959 | 0.898 | 0.349 | 1e-179 | |
| O94383 | 1228 | Structural maintenance of | yes | no | 0.948 | 0.890 | 0.337 | 1e-172 | |
| Q8NDV3 | 1235 | Structural maintenance of | no | no | 0.954 | 0.891 | 0.321 | 1e-159 | |
| Q920F6 | 1248 | Structural maintenance of | no | no | 0.951 | 0.879 | 0.323 | 1e-157 | |
| P32908 | 1225 | Structural maintenance of | yes | no | 0.948 | 0.893 | 0.310 | 1e-132 |
| >sp|Q6Q1P4|SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana GN=SMC1 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 1628 bits (4216), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 820/1204 (68%), Positives = 1003/1204 (83%), Gaps = 53/1204 (4%)
Query: 1 MPSLLSP-GKIHRLELENFKSYKGLQIIGPFSDFTAIIGPNGAGKSNLMDAISFVLGVRT 59
MP++ SP GKI +LE+ENFKSYKG Q++GPF DFTAIIGPNG+GKSNLMDAISFVLGVRT
Sbjct: 1 MPAIQSPSGKILQLEMENFKSYKGHQLVGPFKDFTAIIGPNGSGKSNLMDAISFVLGVRT 60
Query: 60 GQLRGGQLKDLIYAYDDKEKEQKGRRAFVRLVYQLGNESELQFTRTITSSGGSEYRIDGR 119
GQLRG QLKDLIYA+DD++KEQ+GR+AFVRLVYQ+ + EL+FTR+ITS+GGSEYRID R
Sbjct: 61 GQLRGSQLKDLIYAFDDRDKEQRGRKAFVRLVYQMDDGVELRFTRSITSAGGSEYRIDNR 120
Query: 120 VVNWDEYNAKLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGSDELKREYEV 179
VVN DEYN KLRSLGILVKARNFLVFQGDVESIASKNPKELT LLE+ISGS+ELK+EYE
Sbjct: 121 VVNLDEYNGKLRSLGILVKARNFLVFQGDVESIASKNPKELTGLLEEISGSEELKKEYEG 180
Query: 180 LEDEKGKAEEKSALVYQKKRTVVLERKQKKEQKEEAERHLRLQDQLKSLKKEHFLWQLFN 239
LE++K AEEK+AL+YQKK+T+ E+K KK QKEEAE+HLRLQ++LK+LK+E FLWQL+N
Sbjct: 181 LEEKKASAEEKAALIYQKKKTIGNEKKLKKAQKEEAEKHLRLQEELKALKRERFLWQLYN 240
Query: 240 IEKDITKASKDLEAEKRSREEVMRELEHFEDQKRGKRK-ELAKYLKEIAQCEKKIAERNN 298
IE DI KA++D+++EK +R++VMRELE FE ++ GKRK E AKYLKEIAQ EKKIAE+++
Sbjct: 241 IENDIEKANEDVDSEKSNRKDVMRELEKFE-REAGKRKVEQAKYLKEIAQREKKIAEKSS 299
Query: 299 RLDKSQPELLKLNEEMSRINSKIKSSKKELERKREERRKHANDIKELQKGIQDLTGKLEE 358
+L K QPELL+ EE++RI +KI++++K+++++++E+ KH+ +I+++QK I++L K+E
Sbjct: 300 KLGKIQPELLRFKEEIARIKAKIETNRKDVDKRKKEKGKHSKEIEQMQKSIKELNKKMEL 359
Query: 359 LNEKSRDGAGRLPLLDTQLTEYFQIKEEAGMKTAKLRDEKEVLDREQHADLEVLKNLEAN 418
N+K +D +G+LP+LD+QL +YF++KEEAGMKT KLRDE EVL+R++ DLE L+NLE N
Sbjct: 360 FNKKRQDSSGKLPMLDSQLQDYFRLKEEAGMKTIKLRDEHEVLERQRRTDLEALRNLEEN 419
Query: 419 LQQLSNREHELDAQEDQMRKRQKNILDASGGHKDELTKLKKELRSMQDKHRDSRQKYENL 478
QQL NR+++LD Q + + RQ I +S +K+E T LK ELR++Q+KH ++R+ L
Sbjct: 420 YQQLINRKNDLDEQIKRFKDRQGEIETSSSKYKNETTSLKTELRALQEKHVNAREASAKL 479
Query: 479 KSKIGEIENQLRELKADRHENERDAKLSQAVETLKRLFQGVHGRMTDLCRPTQKKYNLAV 538
K++I E+E+QL +L A+R+ENERD++L+QAVE+LKRLFQGVHGRMTDLCRP +KKYNLAV
Sbjct: 480 KTRIAELEDQLSDLTAERYENERDSRLTQAVESLKRLFQGVHGRMTDLCRPNRKKYNLAV 539
Query: 539 TVAMGKFMDAVVVEDENTGKECIK------------------------------------ 562
TVAMG+FMDAVVVEDENTGK+CIK
Sbjct: 540 TVAMGRFMDAVVVEDENTGKDCIKYLKEQRLPPMTFIPLQSVRVKQVFERLRNLGGTAKL 599
Query: 563 -------------AVLFAVGNTLVCDGLDEAKVLSWSGERFRVVTVDGILLTKAGTMTGG 609
AVL+AVGNTLVCD L+EAKVLSWSGERF+VVTVDGILLTKAGTMTGG
Sbjct: 600 VFDVIQFDPELEKAVLYAVGNTLVCDELEEAKVLSWSGERFKVVTVDGILLTKAGTMTGG 659
Query: 610 TTGGMEARSKQWDDKKIEGLKRKKEQYESELEELGSIREMQLRESETSGKISGLEKKIQY 669
T+GGMEA+S +WDDKKIEGLK+ KE +E +LE +GSIREMQ++ESE SGKISGLEKKIQY
Sbjct: 660 TSGGMEAKSNKWDDKKIEGLKKNKEDFEQQLENIGSIREMQMKESEISGKISGLEKKIQY 719
Query: 670 AEIEKRSIEDKLANLRQEKRTIKEEIGRIKPDLQKLKDKIDRRTTDINKLERRINEITDR 729
AEIEK+SI+DKL L QE+R I EEI RIKP+L K + ++D+R T++NKLE+R+NEI DR
Sbjct: 720 AEIEKKSIKDKLPQLEQEERNIIEEIDRIKPELSKARTEVDKRKTEMNKLEKRMNEIVDR 779
Query: 730 LYRDFSESVGVANIREYEENQLKAAQNVAEERLNLSNQLAKLKYQLEYEQKRDVESRIKK 789
+Y+DFS+SVGV NIR YEE QLK A+ AEERL LSNQLAKLKYQLEYEQ RDV SRI+K
Sbjct: 780 IYKDFSQSVGVPNIRVYEETQLKTAEKEAEERLELSNQLAKLKYQLEYEQNRDVGSRIRK 839
Query: 790 LESSLSTLENDLKQVKKKEGDVKSATETATGDITRWKEEMRGWKSNSDECEKEIQEWEKQ 849
+ESS+S+LE DL+ ++K + K T +I WK+EM K S+E EKEI +W+KQ
Sbjct: 840 IESSISSLETDLEGIQKTMSERKETAVKITNEINNWKKEMEECKQKSEEYEKEILDWKKQ 899
Query: 850 ASAATTSLSKLNRQINSKEAQIEQLISRKQEIMEKCELECIVLPTVEDPMETDSSSPGPV 909
AS ATTS++KLNRQI+SKE QIEQLIS+KQEI EKCELE I LP + D ME D S GP
Sbjct: 900 ASQATTSITKLNRQIHSKETQIEQLISQKQEITEKCELEHITLPVLSDAMEEDDSD-GPQ 958
Query: 910 FDFSQLNRSYLQERRPSEREKLEVEFKQKMDALISEIEKTAPNLKALDQYEALLEKERTV 969
FDFS+L R+YLQERRPS REK+E EF+QK+++ SEIE+TAPNL+ALDQYEA+ EKE+ V
Sbjct: 959 FDFSELGRAYLQERRPSAREKVEAEFRQKIESKTSEIERTAPNLRALDQYEAIQEKEKQV 1018
Query: 970 TEEFEAARKEEKQAADAYNSVKQKRYGLFMEAFNHISSSIDRIYKQLTRSNTHPLGGTAY 1029
++EFEAARKEEKQ ADA+N+VKQKRY LFMEAFNHI+S+ID+IYKQLT+SNTHPLGGTAY
Sbjct: 1019 SQEFEAARKEEKQVADAFNTVKQKRYELFMEAFNHIASNIDKIYKQLTKSNTHPLGGTAY 1078
Query: 1030 LNLENEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYKPSPFFILDE 1089
LNLENEDDPFLHGIKYT MPPTKRFRDMEQLSGGEKTVAALALLFSIHSY+PSPFFILDE
Sbjct: 1079 LNLENEDDPFLHGIKYTTMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYRPSPFFILDE 1138
Query: 1090 VDAALDNLNVAKVAGFIRSKSCEGTRGNQDADEGNGFQSIVISLKDSFYDKAEALVGVYR 1149
VDAALDNLNVAKVA FIRSKSC+ R NQDA++GNGFQSIVISLKDSFYDKAEALVGVYR
Sbjct: 1139 VDAALDNLNVAKVAKFIRSKSCQAARDNQDAEDGNGFQSIVISLKDSFYDKAEALVGVYR 1198
Query: 1150 DSDR 1153
D++R
Sbjct: 1199 DTER 1202
|
Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement (By similarity). Essential protein plant viability. Required for chromosome segregation (e.g. sister chromatid alignment) and cell division during embryogenesis. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|O97593|SMC1A_BOVIN Structural maintenance of chromosomes protein 1A OS=Bos taurus GN=SMC1A PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes protein 1A OS=Xenopus laevis GN=smc1a PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O94383|SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8NDV3|SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens GN=SMC1B PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q920F6|SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus GN=Smc1b PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P32908|SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1154 | ||||||
| 255582489 | 1220 | Structural maintenance of chromosome 1 p | 0.999 | 0.945 | 0.776 | 0.0 | |
| 224085641 | 1232 | condensin complex components subunit [Po | 0.998 | 0.935 | 0.754 | 0.0 | |
| 356536995 | 1216 | PREDICTED: structural maintenance of chr | 0.998 | 0.947 | 0.744 | 0.0 | |
| 356548057 | 1216 | PREDICTED: structural maintenance of chr | 0.998 | 0.947 | 0.744 | 0.0 | |
| 45594277 | 1218 | structural maintenance of chromosomes 1 | 0.997 | 0.944 | 0.680 | 0.0 | |
| 218187327 | 1246 | hypothetical protein OsI_39293 [Oryza sa | 0.991 | 0.918 | 0.602 | 0.0 | |
| 302817360 | 1205 | hypothetical protein SELMODRAFT_428807 [ | 0.997 | 0.955 | 0.613 | 0.0 | |
| 222617555 | 1221 | hypothetical protein OsJ_37035 [Oryza sa | 0.969 | 0.916 | 0.596 | 0.0 | |
| 242079535 | 1253 | hypothetical protein SORBIDRAFT_07g02343 | 0.991 | 0.913 | 0.579 | 0.0 | |
| 79444781 | 1238 | structural maintenance of chromosomes 1 | 0.974 | 0.907 | 0.581 | 0.0 |
| >gi|255582489|ref|XP_002532030.1| Structural maintenance of chromosome 1 protein, putative [Ricinus communis] gi|223528300|gb|EEF30346.1| Structural maintenance of chromosome 1 protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1795 bits (4650), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 935/1204 (77%), Positives = 1048/1204 (87%), Gaps = 51/1204 (4%)
Query: 1 MPSLLSPGKIHRLELENFKSYKGLQIIGPFSDFTAIIGPNGAGKSNLMDAISFVLGVRTG 60
MPS++S GKI +LE+ENFKSYKG Q IGPF DFTAIIGPNGAGKSNLMDAISFVLGVRTG
Sbjct: 1 MPSMISTGKILKLEIENFKSYKGQQTIGPFKDFTAIIGPNGAGKSNLMDAISFVLGVRTG 60
Query: 61 QLRGGQLKDLIYAYDDKEKEQKGRRAFVRLVYQLGNESELQFTRTITSSGGSEYRIDGRV 120
QLRG QLKDLIYAYDD+EKEQKGRRA+VRLVY L + SEL FTRTITSSG SEYRIDG+V
Sbjct: 61 QLRGAQLKDLIYAYDDREKEQKGRRAYVRLVYLLASGSELHFTRTITSSGSSEYRIDGKV 120
Query: 121 VNWDEYNAKLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGSDELKREYEVL 180
VNWDEYN +LRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGS++LKREYE L
Sbjct: 121 VNWDEYNGRLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGSEDLKREYEDL 180
Query: 181 EDEKGKAEEKSALVYQKKRTVVLERKQKKEQKEEAERHLRLQDQLKSLKKEHFLWQLFNI 240
E+ K +AEE SALVYQKKRTVV+ERKQKKEQKEEAE+HLRLQDQLK+LKKEHFLWQLF I
Sbjct: 181 EERKARAEENSALVYQKKRTVVMERKQKKEQKEEAEKHLRLQDQLKALKKEHFLWQLFII 240
Query: 241 EKDITKASKDLEAEKRSREEVMRELEHFEDQKRGKRKELAKYLKEIAQCEKKIAERNNRL 300
+KDI K + DLE EKR+RE VM+ELE F ++ K+KELAKYLKEIAQCE+KIAER+++L
Sbjct: 241 DKDINKINDDLETEKRNREGVMQELEKFNIEENKKKKELAKYLKEIAQCERKIAERSSKL 300
Query: 301 DKSQPELLKLNEEMSRINSKIKSSKKELERKREERRKHANDIKELQKGIQDLTGKLEELN 360
DK+QPELLKLNE M+RINSKIKSS+KEL++KREERRKHA++I ELQKGI DLT KLE+L+
Sbjct: 301 DKNQPELLKLNEAMTRINSKIKSSRKELDKKREERRKHADEIDELQKGILDLTAKLEDLH 360
Query: 361 EKSRDGAGRLPLLDTQLTEYFQIKEEAGMKTAKLRDEKEVLDREQHADLEVLKNLEANLQ 420
EKSRD + +LPL D QLTEYF+IKE+AGMKT KLR+EKEVLDR+QHAD+E KNLE NLQ
Sbjct: 361 EKSRDTSDKLPLADGQLTEYFRIKEDAGMKTIKLREEKEVLDRQQHADMEAQKNLEENLQ 420
Query: 421 QLSNREHELDAQEDQMRKRQKNILDASGGHKDELTKLKKELRSMQDKHRDSRQKYENLKS 480
QL NRE EL+AQE QMR RQ+ I + S +K EL LKK+ R M DKHRDSR K ENLKS
Sbjct: 421 QLKNRESELNAQEAQMRARQEKIQETSTKNKKELADLKKDSREMHDKHRDSRIKCENLKS 480
Query: 481 KIGEIENQLRELKADRHENERDAKLSQAVETLKRLFQGVHGRMTDLCRPTQKKYNLAVTV 540
+IGE+E QLRE+KAD++ENERDA+LSQAVE LKRLFQGVHGRMTDLCRPTQKKYNLAVTV
Sbjct: 481 RIGEVEIQLREVKADKYENERDARLSQAVEDLKRLFQGVHGRMTDLCRPTQKKYNLAVTV 540
Query: 541 AMGKFMDAVVVEDENTGKECIK-------------------------------------- 562
AMG+FMDAVVVEDE TGKECIK
Sbjct: 541 AMGRFMDAVVVEDEYTGKECIKYLKEKRLPPQTFIPLQSVRVKPIIERLRTLGGTAKLNY 600
Query: 563 ---------AVLFAVGNTLVCDGLDEAKVLSWSGERFRVVTVDGILLTKAGTMTGGTTGG 613
A+LFAVGNTLVCD LDEAKVLSWSGERF+VVTVDGILLTK+GTMTGGT+GG
Sbjct: 601 CTFDPVLEKAILFAVGNTLVCDDLDEAKVLSWSGERFKVVTVDGILLTKSGTMTGGTSGG 660
Query: 614 MEARSKQWDDKKIE----GLKRKKEQYESELEELGSIREMQLRESETSGKISGLEKKIQY 669
MEARSKQWD+ KI+ LK+KKEQ E ELEELGS REM+L+ESE SGKISGLEKKIQY
Sbjct: 661 MEARSKQWDNDKIKESIAKLKKKKEQLEKELEELGSDREMKLKESEASGKISGLEKKIQY 720
Query: 670 AEIEKRSIEDKLANLRQEKRTIKEEIGRIKPDLQKLKDKIDRRTTDINKLERRINEITDR 729
AEIEKRSI+DKL L++EK+ IKEE RIKP+L KLKD ID+R T+I KLE+RINEI DR
Sbjct: 721 AEIEKRSIKDKLETLKREKQIIKEETDRIKPELLKLKDGIDKRATEIRKLEKRINEIIDR 780
Query: 730 LYRDFSESVGVANIREYEENQLKAAQNVAEERLNLSNQLAKLKYQLEYEQKRDVESRIKK 789
+Y+DF + VGV NIREYEEN LKAAQ+VAEERLN+SNQLAKLKYQLEYEQKRD+ESRIKK
Sbjct: 781 IYKDFGKVVGVTNIREYEENHLKAAQHVAEERLNISNQLAKLKYQLEYEQKRDMESRIKK 840
Query: 790 LESSLSTLENDLKQVKKKEGDVKSATETATGDITRWKEEMRGWKSNSDECEKEIQEWEKQ 849
LE+S+S+LEN+LKQ++KKE +VK ATE ATGD+ +WKEE+R WKS ++ECEKE+ EW KQ
Sbjct: 841 LETSISSLENELKQIQKKEAEVKLATEKATGDMDKWKEEVRDWKSKAEECEKEMLEWRKQ 900
Query: 850 ASAATTSLSKLNRQINSKEAQIEQLISRKQEIMEKCELECIVLPTVEDPMETDSSSPGPV 909
SAATTS+SKLNRQINSKE QIEQL+SRKQ+I+EKCELE I LPT+ DPME DS PGP
Sbjct: 901 GSAATTSISKLNRQINSKEGQIEQLLSRKQDIVEKCELEHINLPTISDPMEVDSMIPGPF 960
Query: 910 FDFSQLNRSYLQERRPSEREKLEVEFKQKMDALISEIEKTAPNLKALDQYEALLEKERTV 969
FDFS+LNRS LQ+RRPS+REKLEV+FKQKMDA++SEIEKTAPNLKALDQYEAL EKER V
Sbjct: 961 FDFSELNRSLLQDRRPSDREKLEVDFKQKMDAIMSEIEKTAPNLKALDQYEALQEKERVV 1020
Query: 970 TEEFEAARKEEKQAADAYNSVKQKRYGLFMEAFNHISSSIDRIYKQLTRSNTHPLGGTAY 1029
TEEFEAARKEEK+ ADAYNSVKQ+RY LFMEAFNHIS++ID+IYKQLT+SNTHPLGGTAY
Sbjct: 1021 TEEFEAARKEEKRVADAYNSVKQRRYELFMEAFNHISNNIDKIYKQLTKSNTHPLGGTAY 1080
Query: 1030 LNLENEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYKPSPFFILDE 1089
LNL+NEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSY+PSPFFILDE
Sbjct: 1081 LNLDNEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYRPSPFFILDE 1140
Query: 1090 VDAALDNLNVAKVAGFIRSKSCEGTRGNQDADEGNGFQSIVISLKDSFYDKAEALVGVYR 1149
VDAALDNLNVAKVAGFIRSKSCEG R NQ+AD G+GFQSIVISLKDSFYDKAEALVGVYR
Sbjct: 1141 VDAALDNLNVAKVAGFIRSKSCEGVRSNQNADGGSGFQSIVISLKDSFYDKAEALVGVYR 1200
Query: 1150 DSDR 1153
DS+R
Sbjct: 1201 DSER 1204
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224085641|ref|XP_002307647.1| condensin complex components subunit [Populus trichocarpa] gi|222857096|gb|EEE94643.1| condensin complex components subunit [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356536995|ref|XP_003537017.1| PREDICTED: structural maintenance of chromosomes protein 1A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356548057|ref|XP_003542420.1| PREDICTED: structural maintenance of chromosomes protein 1A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|45594277|gb|AAS68515.1| structural maintenance of chromosomes 1 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|218187327|gb|EEC69754.1| hypothetical protein OsI_39293 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|302817360|ref|XP_002990356.1| hypothetical protein SELMODRAFT_428807 [Selaginella moellendorffii] gi|300141918|gb|EFJ08625.1| hypothetical protein SELMODRAFT_428807 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|222617555|gb|EEE53687.1| hypothetical protein OsJ_37035 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242079535|ref|XP_002444536.1| hypothetical protein SORBIDRAFT_07g023430 [Sorghum bicolor] gi|241940886|gb|EES14031.1| hypothetical protein SORBIDRAFT_07g023430 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|79444781|ref|NP_191027.3| structural maintenance of chromosomes 1 [Arabidopsis thaliana] gi|332645742|gb|AEE79263.1| structural maintenance of chromosomes 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1154 | ||||||
| ZFIN|ZDB-GENE-090506-9 | 1232 | smc1a "structural maintenance | 0.475 | 0.445 | 0.368 | 2.1e-154 | |
| UNIPROTKB|Q14683 | 1233 | SMC1A "Structural maintenance | 0.475 | 0.445 | 0.366 | 1e-152 | |
| MGI|MGI:1344345 | 1233 | Smc1a "structural maintenance | 0.475 | 0.445 | 0.366 | 1.3e-152 | |
| UNIPROTKB|E2QV07 | 1233 | SMC1A "Structural maintenance | 0.475 | 0.445 | 0.366 | 1.3e-152 | |
| UNIPROTKB|O97593 | 1233 | SMC1A "Structural maintenance | 0.475 | 0.445 | 0.366 | 1.7e-152 | |
| UNIPROTKB|F2Z5A8 | 1233 | LOC100523938 "Structural maint | 0.475 | 0.445 | 0.366 | 1.7e-152 | |
| UNIPROTKB|I3LMC6 | 1235 | LOC100523938 "Structural maint | 0.475 | 0.444 | 0.366 | 7.3e-152 | |
| RGD|61991 | 1233 | Smc1a "structural maintenance | 0.475 | 0.445 | 0.365 | 9.3e-152 | |
| UNIPROTKB|Q9Z1M9 | 1233 | Smc1a "Structural maintenance | 0.475 | 0.445 | 0.365 | 9.3e-152 | |
| UNIPROTKB|G3X7C0 | 1232 | SMC1A "Structural maintenance | 0.475 | 0.445 | 0.366 | 6.5e-151 |
| ZFIN|ZDB-GENE-090506-9 smc1a "structural maintenance of chromosomes 1A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 924 (330.3 bits), Expect = 2.1e-154, Sum P(2) = 2.1e-154
Identities = 209/567 (36%), Positives = 330/567 (58%)
Query: 8 GKIHRLELENFKSYKGLQIIGPFSDFTAIIGPNGAGKSNLMDAISFVLGVRTGQLRGGQL 67
G + +E+ENFKSYKG QIIGPF FTAIIGPNG+GKSNLMDAISFVL +T LR L
Sbjct: 2 GYLKLIEIENFKSYKGRQIIGPFHKFTAIIGPNGSGKSNLMDAISFVLAEKTSNLRVKTL 61
Query: 68 KDLIYAYDDKEKEQKGRRAFVRLVYQLGNESELQFTRTITSSGGSEYRIDGRVVNWDEYN 127
KDLI+ + RAFV +VY N E FTR I S SEYRI+ +VV +Y+
Sbjct: 62 KDLIHGAP--VGKPAANRAFVSMVYCEDNGEECTFTRAIIGSS-SEYRINSKVVGLSDYS 118
Query: 128 AKLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGSDELKREYEVLEDEKGKA 187
+L LGIL+KARNFLVFQG VESIA KNPKE TAL E+IS S EL +EY+ + E KA
Sbjct: 119 EELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKEMVKA 178
Query: 188 EEKSALVYQKKRTVVLXXXXXXXXXXXXXXHLRLQDQLKSLKKEHFLWQLFNIEKDITKA 247
EE + Y +K+ + + RL+D++ + L++L++ E++I K
Sbjct: 179 EEDTQFSYHRKKNIAAERKEAKQEKEEAERYQRLKDEVVRAHVQLQLFKLYHNEEEIEKL 238
Query: 248 SKDLEAEKRSREEVMRELEHFEDQKRGKRKELAKYLKEIAQCEKKIAERNNRLDKSQPEL 307
+++L R ++ ++++H E++ + K+KEL + +++ EK+I E++ L++ +P+
Sbjct: 239 NRELSQRNREIDKDRKKMDHVEEELKDKKKELGRMMRDQQNVEKEIKEKDAELNQKRPQY 298
Query: 308 LKLNEEMXXXXXXXXXXXXXXXXXXXXXXXHANDIKEL--QKGIQDLTGK-LEELNEKSR 364
+K E DI+EL ++G +++ + EE E+
Sbjct: 299 IKAKENTAHKIKKLEVARKSLQNAQKMYKKRKADIEELDREQGAVEMSRQEFEERMEEEA 358
Query: 365 DGAGR-LPLLDTQLTEYFQIKEEAGMKTAKLRDEKEVLDREQHAD-----LEVLKNLEAN 418
G+ L L + Q+ +Y ++KEEA + A L E E +R+Q AD LE K +E
Sbjct: 359 QSQGQDLTLEENQVKQYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKIETE 418
Query: 419 LQQLSNREHELDAQEDQMRKRQKNILDASGGHKDELTKLKKELRSMQDKHRDSRQKYENL 478
+ + + E++ + ++ K + I S DE ++++EL + ++++ + +
Sbjct: 419 AK-IKQKIREIEENQKRIEKLEDYIA-TSRQSLDEQRRMEEELTEEVEL---AKRRIDEI 473
Query: 479 KSKIGEIENQLRELKADRHENERDAKLSQAVETLKRLFQG-VHGRMTDLCRPTQKKYNLA 537
++ ++ QL + + DR EN R + ++ +E++KRL+ G V+GR+ DLC+PTQKKY +A
Sbjct: 474 NMELNQVMEQLGDARIDRQENSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIA 533
Query: 538 VTVAMGKFMDAVVVEDENTGKECIKAV 564
VT +GK MDA++V+ E TG++CI+ +
Sbjct: 534 VTKVLGKNMDAIIVDSEKTGRDCIQYI 560
|
|
| UNIPROTKB|Q14683 SMC1A "Structural maintenance of chromosomes protein 1A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1344345 Smc1a "structural maintenance of chromosomes 1A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QV07 SMC1A "Structural maintenance of chromosomes protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O97593 SMC1A "Structural maintenance of chromosomes protein 1A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5A8 LOC100523938 "Structural maintenance of chromosomes protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LMC6 LOC100523938 "Structural maintenance of chromosomes protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|61991 Smc1a "structural maintenance of chromosomes 1A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Z1M9 Smc1a "Structural maintenance of chromosomes protein 1A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X7C0 SMC1A "Structural maintenance of chromosomes protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q6Q1P4 | SMC1_ARATH | No assigned EC number | 0.6810 | 0.9974 | 0.9449 | yes | no |
| P32908 | SMC1_YEAST | No assigned EC number | 0.3104 | 0.9480 | 0.8930 | yes | no |
| O94383 | SMC1_SCHPO | No assigned EC number | 0.3370 | 0.9480 | 0.8908 | yes | no |
| Q9CU62 | SMC1A_MOUSE | No assigned EC number | 0.3527 | 0.9601 | 0.8986 | yes | no |
| O97593 | SMC1A_BOVIN | No assigned EC number | 0.3527 | 0.9601 | 0.8986 | yes | no |
| Q14683 | SMC1A_HUMAN | No assigned EC number | 0.3514 | 0.9636 | 0.9018 | yes | no |
| Q9Z1M9 | SMC1A_RAT | No assigned EC number | 0.3519 | 0.9601 | 0.8986 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1154 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-133 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-102 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-79 | |
| cd03275 | 247 | cd03275, ABC_SMC1_euk, ATP-binding cassette domain | 8e-77 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-73 | |
| cd03275 | 247 | cd03275, ABC_SMC1_euk, ATP-binding cassette domain | 5e-55 | |
| cd03274 | 212 | cd03274, ABC_SMC4_euk, ATP-binding cassette domain | 6e-25 | |
| cd03274 | 212 | cd03274, ABC_SMC4_euk, ATP-binding cassette domain | 2e-24 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 2e-23 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 9e-22 | |
| cd03239 | 178 | cd03239, ABC_SMC_head, The SMC head domain belongs | 3e-21 | |
| cd03239 | 178 | cd03239, ABC_SMC_head, The SMC head domain belongs | 6e-20 | |
| cd03273 | 251 | cd03273, ABC_SMC2_euk, ATP-binding cassette domain | 2e-17 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 3e-17 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 4e-15 | |
| cd03272 | 243 | cd03272, ABC_SMC3_euk, ATP-binding cassette domain | 7e-14 | |
| cd03273 | 251 | cd03273, ABC_SMC2_euk, ATP-binding cassette domain | 4e-13 | |
| cd03272 | 243 | cd03272, ABC_SMC3_euk, ATP-binding cassette domain | 2e-11 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 1e-10 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 2e-10 | |
| smart00968 | 120 | smart00968, SMC_hinge, SMC proteins Flexible Hinge | 4e-10 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-10 | |
| PRK00064 | 361 | PRK00064, recF, recombination protein F; Reviewed | 1e-09 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 4e-09 | |
| pfam06470 | 117 | pfam06470, SMC_hinge, SMC proteins Flexible Hinge | 4e-09 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-08 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 2e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-08 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 3e-08 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 8e-08 | |
| pfam13555 | 60 | pfam13555, AAA_29, P-loop containing region of AAA | 9e-08 | |
| cd03276 | 198 | cd03276, ABC_SMC6_euk, ATP-binding cassette domain | 3e-07 | |
| cd03276 | 198 | cd03276, ABC_SMC6_euk, ATP-binding cassette domain | 3e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-07 | |
| cd03279 | 213 | cd03279, ABC_sbcCD, ATP-binding cassette domain of | 4e-07 | |
| cd03241 | 276 | cd03241, ABC_RecN, ATP-binding cassette domain of | 6e-07 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 7e-07 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 7e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 8e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-06 | |
| COG1195 | 363 | COG1195, RecF, Recombinational DNA repair ATPase ( | 1e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| COG0497 | 557 | COG0497, RecN, ATPase involved in DNA repair [DNA | 2e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-06 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 7e-06 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 9e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-05 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 1e-05 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 1e-05 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 1e-05 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 2e-05 | |
| cd03242 | 270 | cd03242, ABC_RecF, ATP-binding cassette domain of | 2e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-05 | |
| COG1106 | 371 | COG1106, COG1106, Predicted ATPases [General funct | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 4e-05 | |
| cd03277 | 213 | cd03277, ABC_SMC5_euk, ATP-binding cassette domain | 4e-05 | |
| cd03277 | 213 | cd03277, ABC_SMC5_euk, ATP-binding cassette domain | 5e-05 | |
| pfam13304 | 256 | pfam13304, AAA_21, AAA domain | 6e-05 | |
| TIGR00634 | 563 | TIGR00634, recN, DNA repair protein RecN | 6e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-05 | |
| TIGR00611 | 365 | TIGR00611, recf, recF protein | 9e-05 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 1e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 2e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| COG4637 | 373 | COG4637, COG4637, Predicted ATPase [General functi | 3e-04 | |
| pfam05667 | 536 | pfam05667, DUF812, Protein of unknown function (DU | 3e-04 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 3e-04 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 3e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 4e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 4e-04 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 4e-04 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 4e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 5e-04 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 5e-04 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 6e-04 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 6e-04 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 6e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 7e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-04 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 8e-04 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 9e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.001 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.001 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 0.001 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 0.001 | |
| pfam13558 | 79 | pfam13558, SbcCD_C, Putative exonuclease SbcCD, C | 0.001 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 0.001 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 0.001 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 0.001 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.002 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.002 | |
| pfam13175 | 320 | pfam13175, AAA_15, AAA ATPase domain | 0.002 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 0.002 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.002 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 0.002 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 0.002 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 0.002 | |
| pfam01496 | 707 | pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni | 0.002 | |
| COG4604 | 252 | COG4604, CeuD, ABC-type enterochelin transport sys | 0.002 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 0.003 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.003 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.003 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 0.003 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 0.003 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 0.003 | |
| pfam08317 | 321 | pfam08317, Spc7, Spc7 kinetochore protein | 0.003 | |
| pfam10146 | 215 | pfam10146, zf-C4H2, Zinc finger-containing protein | 0.003 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 0.004 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.004 | |
| pfam12252 | 1443 | pfam12252, SidE, Dot/Icm substrate protein | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 434 bits (1119), Expect = e-133
Identities = 300/1205 (24%), Positives = 577/1205 (47%), Gaps = 121/1205 (10%)
Query: 9 KIHRLELENFKSYKGLQIIGPFSDFTAIIGPNGAGKSNLMDAISFVLGVRTG-QLRGGQL 67
+ R+EL+ FKS+ I FTAI+GPNG+GKSN++DAI FVLG ++ LR ++
Sbjct: 2 YLKRIELKGFKSFADPTEINFSPGFTAIVGPNGSGKSNIVDAIRFVLGEQSAKNLRASKM 61
Query: 68 KDLIYAYDDKEKEQKGRRAFVRLV------YQLGNESELQFTRTITSSGGSEYRIDGRVV 121
DLI+A K A V L E+ TR I G SEY I+G V
Sbjct: 62 SDLIFAGSGNRKPAN--YAEVELTFDNSDNTLPLEYEEISVTRRIYRDGESEYYINGEKV 119
Query: 122 NWDEYNAKLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQISGSDELKREYEVLE 181
+ L GI ++ + V QG VE I + P+E L+E+ +G + K E E
Sbjct: 120 RLKDIQDLLADSGIGKESYSI-VSQGKVEEIINAKPEERRKLIEEAAGVSKYKERKEEAE 178
Query: 182 DEKGKAEEKSALVYQKKRTVVLERKQKKEQKEEAERHLRLQDQLKSLKKEHFLWQLFNIE 241
+ + EE + + + ++ + Q E+AER+ L+ +L+ L+ L +L +
Sbjct: 179 RKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRELELALLLAKLKELR 238
Query: 242 KDITKASKDLEAEKRSREEVMRELEHFEDQKRGKRKELAKYLKEIAQCEKKIAERNNRLD 301
K++ + ++L + EE+ ELE E + + EL + +E+ + ++++ E ++
Sbjct: 239 KELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIE 298
Query: 302 KSQPELLKLNEEMSRINSKIKSSKKELERKREERRKHANDIKELQKGIQDLTGKLEELNE 361
+ + E+ L E + + ++++ ++ LE +E+ +++E + +++L L EL E
Sbjct: 299 ELEGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEE 358
Query: 362 KSRDGAGRLPLLDTQLTEYFQIKEEAGMKTAKLRDEKEVLDREQHADLEVLKNLEANLQQ 421
+ +L L +L E F+ E + A+L E + E +++LE L++
Sbjct: 359 AKEELEEKLSALLEELEELFEALRE---ELAELEAELAEIRNELEELKREIESLEERLER 415
Query: 422 LSNREHELDAQEDQMRKRQKNILDASGGHKDELTKLKKELRSMQDKHRDSRQKYENLKSK 481
LS R +L + ++ + + +EL +L+++L ++D+ ++ ++ L+ +
Sbjct: 416 LSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEE 475
Query: 482 IGEIENQLRELKA--DRHENERDAK--LSQAVETLKRLFQGVHGRMTDLCRPTQKKYNLA 537
+ +E +L L+A DR E E+ A + +E L+ GV+G + +L + +KY A
Sbjct: 476 LQRLEKELSSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYGPVAELIKVK-EKYETA 534
Query: 538 VTVAMGKFMDAVVVEDENTGKECI------------------------------------ 561
+ A+G + AVVVE+E K+ I
Sbjct: 535 LEAALGNRLQAVVVENEEVAKKAIEFLKENKAGRATFLPLDRIKPLRSLKSDAAPGFLGL 594
Query: 562 ------------KAVLFAVGNTLVCDGLDEAKVLSWS-GERFRVVTVDGILLTKAGTMTG 608
AV F +G+TLV D L++A+ L+ ++R+VT+DG L+ +G++TG
Sbjct: 595 ASDLIDFDPKYEPAVRFVLGDTLVVDDLEQARRLARKLRIKYRIVTLDGDLVEPSGSITG 654
Query: 609 GTTGGMEARSKQWDDKKIEGLKRKKEQYESELEELGSIREMQLRESETSGKISGLEKKIQ 668
G+ RS ++++ L+ + + E++LE+L ++ LE ++
Sbjct: 655 GSR---NKRSSLAQKRELKELEEELAELEAQLEKLEE------ELKSLKNELRSLEDLLE 705
Query: 669 YAEIEKRSIEDKLANLRQEKRTIKEEIGRIKPDLQKLKDKIDRRTTDINKLERRINEITD 728
+ +E +L L++E ++EE+ +++ L++L+++++ ++ +L+ R+ E+ +
Sbjct: 706 ELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEE 765
Query: 729 RLYRDFSESVGVANIREYEENQLKAAQNVAEERLNLSNQLAKLKYQLEYEQKRDVESRIK 788
L +A ++E E + Q + EE L +L + + + +E ++
Sbjct: 766 ELESLEEA---LAKLKEEIEELEEKRQALQEELEELEEELEEAE-----RRLDALERELE 817
Query: 789 KLESSLSTLENDLKQVKKKEGDVKSATETATGDITRWKEEMRGWKSNSDECEKEIQEWEK 848
LE LE ++++++++ +++ + ++ ++E+ K +E E E +E E
Sbjct: 818 SLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELED 877
Query: 849 QASAATTSLSKLNRQINSKEAQIEQLISRKQEIMEKCELECIVLPTVEDPMETDSSSPGP 908
+ +L ++ E+++ +L +++ E+ E L +E
Sbjct: 878 ELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLE------------ 925
Query: 909 VFDFSQLNRSYLQERRPSEREKLEVEFKQKMDALISEIEKTAP-NLKALDQYEALLEKER 967
+L + E + LE E +++++ L EIE P NL+A+++YE + E+
Sbjct: 926 ----VELPELEEELEEEYE-DTLETELEREIERLEEEIEALGPVNLRAIEEYEEVEERYE 980
Query: 968 TVTEEFEAARKEEKQAADAYNSVKQKRYGLFMEAFNHISSSIDRIYKQLTRSNTHPLGGT 1027
+ + E + +++ + + +++ F E F+ I+ + I+K+L GGT
Sbjct: 981 ELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFKELFG------GGT 1034
Query: 1028 AYLNLENEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYKPSPFFIL 1087
A L L DDP GI+ +A PP K+ + + LSGGEK++ ALALLF+I Y+P+PF++L
Sbjct: 1035 AELELTEPDDPLTAGIEISARPPGKKLQSLSLLSGGEKSLTALALLFAIQKYRPAPFYVL 1094
Query: 1088 DEVDAALDNLNVAKVAGFIRSKSCEGTRGNQDADEGNGFQSIVISLKDSFYDKAEALVGV 1147
DEVDAALD+ NV +VA I+ S Q IVI+ + + A+ LVGV
Sbjct: 1095 DEVDAALDDANVERVARLIKEMS-------------KETQFIVITHRKGTMEAADRLVGV 1141
Query: 1148 YRDSD 1152
Sbjct: 1142 TMQEK 1146
|
Length = 1163 |
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213239 cd03272, ABC_SMC3_euk, ATP-binding cassette domain of eukaryotic SMC3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213239 cd03272, ABC_SMC3_euk, ATP-binding cassette domain of eukaryotic SMC3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214944 smart00968, SMC_hinge, SMC proteins Flexible Hinge Domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234608 PRK00064, recF, recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|219044 pfam06470, SMC_hinge, SMC proteins Flexible Hinge Domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205733 pfam13555, AAA_29, P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|213243 cd03276, ABC_SMC6_euk, ATP-binding cassette domain of eukaryotic SM6 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213243 cd03276, ABC_SMC6_euk, ATP-binding cassette domain of eukaryotic SM6 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213246 cd03279, ABC_sbcCD, ATP-binding cassette domain of sbcCD | Back alignment and domain information |
|---|
| >gnl|CDD|213208 cd03241, ABC_RecN, ATP-binding cassette domain of RecN | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224116 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|213209 cd03242, ABC_RecF, ATP-binding cassette domain of RecF | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224031 COG1106, COG1106, Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222036 pfam13304, AAA_21, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233065 TIGR00634, recN, DNA repair protein RecN | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233051 TIGR00611, recf, recF protein | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226984 COG4637, COG4637, Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|222219 pfam13558, SbcCD_C, Putative exonuclease SbcCD, C subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|221957 pfam13175, AAA_15, AAA ATPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family | Back alignment and domain information |
|---|
| >gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|204405 pfam10146, zf-C4H2, Zinc finger-containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221489 pfam12252, SidE, Dot/Icm substrate protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1154 | |||
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 100.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 100.0 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 100.0 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 100.0 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 100.0 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 100.0 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 100.0 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 100.0 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 100.0 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 100.0 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 100.0 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 100.0 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 100.0 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 100.0 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 99.97 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.97 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.96 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.95 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.95 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.94 | |
| PF13514 | 1111 | AAA_27: AAA domain | 99.94 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.93 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.92 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.9 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.89 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 99.88 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.88 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.87 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.87 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 99.86 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 99.84 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.84 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.83 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 99.82 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 99.82 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.82 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 99.82 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.81 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.8 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 99.79 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.79 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.72 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.71 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 99.7 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.7 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.69 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.69 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 99.67 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.67 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 99.62 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.62 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.6 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.6 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.6 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.6 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.6 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.58 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.56 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.54 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.52 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.51 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.51 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.51 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.49 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.49 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.49 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.48 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.47 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.47 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 99.46 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.44 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.44 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.43 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.43 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.43 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.43 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.4 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.4 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.39 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 99.39 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.38 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.38 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.38 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.38 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.37 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.36 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 99.35 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.35 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.35 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.34 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.34 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.34 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.33 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.33 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.33 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.32 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.32 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.32 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.32 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.31 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.31 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.31 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.31 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.31 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.31 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.31 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.3 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.3 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.3 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.3 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.3 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.3 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.3 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.3 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.3 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.3 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.29 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.29 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.29 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.29 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.29 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.29 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.29 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.29 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.29 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.29 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.29 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.29 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.29 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 99.29 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.29 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.29 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.29 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.29 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.29 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.28 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.28 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.28 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.28 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.28 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.28 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.28 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.28 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.28 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.28 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.28 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.28 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.28 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.28 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.27 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.27 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.27 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.27 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 99.27 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.27 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.27 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.27 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.27 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.27 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.27 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.27 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.27 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.27 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.27 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.27 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.27 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.27 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.27 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.27 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.27 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.26 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.26 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 99.26 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.26 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.26 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.26 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.26 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.26 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.26 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.26 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.26 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 99.25 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.25 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.25 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.25 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.25 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.25 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.25 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.25 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 99.25 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.25 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.25 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.25 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.25 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.25 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.25 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.25 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.25 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.24 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.24 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.24 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.24 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.24 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.24 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.24 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.24 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.24 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.24 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.24 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 99.24 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.24 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.24 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.23 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.23 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.23 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.23 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.23 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.23 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.23 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.23 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.23 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.23 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.23 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.23 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.23 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.23 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.23 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.23 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.23 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.22 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.22 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.22 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.22 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.22 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.22 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.22 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.22 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.22 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.22 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.22 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.22 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.22 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.22 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.21 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.21 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.21 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.21 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.21 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.21 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.21 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.21 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.21 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.21 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.21 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.2 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.2 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.2 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.2 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.2 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.2 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.2 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.2 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.2 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.2 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.2 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.19 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.19 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.19 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 99.19 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.19 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.19 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.19 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 99.19 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.19 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.19 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.19 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.19 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.19 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.19 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.19 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.19 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.19 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.18 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.18 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.18 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.18 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.18 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.18 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.18 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.18 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.18 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.18 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.18 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.18 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.18 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.18 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.18 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.18 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.17 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.17 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.17 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.17 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.17 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.17 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.17 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.17 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.17 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.17 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.16 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.16 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.16 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.16 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 99.16 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.16 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.16 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.15 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.15 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.15 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 99.15 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.15 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.15 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.15 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 99.15 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.15 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.14 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.14 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 99.14 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.14 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.14 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 99.14 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.13 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.13 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.13 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.13 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.12 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.12 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.12 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.12 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.12 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.11 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.11 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.11 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.11 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 99.11 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.1 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.1 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 99.1 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 99.1 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.09 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 99.09 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.09 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.08 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.08 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.07 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.07 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.07 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.07 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.06 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 99.06 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.06 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 99.06 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 99.05 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.05 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.05 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 99.05 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.05 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.04 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.04 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.04 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.04 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.04 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.04 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.03 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.03 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.02 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.01 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 99.01 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.01 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 99.0 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.0 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.0 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.0 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.0 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 98.99 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 98.99 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 98.98 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.97 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.97 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 98.97 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 98.97 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 98.94 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.94 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 98.94 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 98.94 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 98.94 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 98.93 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 98.93 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.92 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.92 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 98.92 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 98.91 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 98.9 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.87 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 98.87 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 98.86 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 98.86 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 98.85 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 98.85 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 98.84 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 98.84 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 98.84 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 98.83 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 98.83 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.82 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 98.81 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.8 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.77 | |
| COG3950 | 440 | Predicted ATP-binding protein involved in virulenc | 98.77 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 98.76 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 98.76 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 98.75 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 98.74 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 98.74 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 98.74 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 98.74 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 98.73 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 98.73 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 98.72 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 98.71 | |
| PF06470 | 120 | SMC_hinge: SMC proteins Flexible Hinge Domain; Int | 98.69 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 98.69 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.68 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 98.67 | |
| PF11398 | 373 | DUF2813: Protein of unknown function (DUF2813); In | 98.67 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 98.65 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 98.65 | |
| COG1106 | 371 | Predicted ATPases [General function prediction onl | 98.64 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.62 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.61 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 98.61 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 98.6 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 98.59 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.55 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 98.51 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.51 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.51 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 98.45 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 98.45 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 98.43 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.43 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 98.42 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 98.42 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.42 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 98.4 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.39 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 98.38 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.38 | |
| PF13558 | 90 | SbcCD_C: Putative exonuclease SbcCD, C subunit; PD | 98.38 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 98.37 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.36 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.35 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 98.35 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.32 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 98.31 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 98.29 | |
| COG3593 | 581 | Predicted ATP-dependent endonuclease of the OLD fa | 98.27 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.27 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 98.24 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 98.24 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.21 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.17 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 98.15 | |
| COG4694 | 758 | Uncharacterized protein conserved in bacteria [Fun | 98.14 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 98.14 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 98.12 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 98.12 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.08 |
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-133 Score=1133.67 Aligned_cols=1076 Identities=44% Similarity=0.725 Sum_probs=979.1
Q ss_pred CCceeEEEEecceeccCceeecCCCCeEEEEcCCCCCHHHHHHHHHHHhCcccccccccccchhhhcccchhhhcccceE
Q 036401 7 PGKIHRLELENFKSYKGLQIIGPFSDFTAIIGPNGAGKSNLMDAISFVLGVRTGQLRGGQLKDLIYAYDDKEKEQKGRRA 86 (1154)
Q Consensus 7 ~~~i~~l~l~nFks~~~~~~i~~~~~~~~IvG~NGsGKS~ildAi~~~lg~~~~~~r~~~~~~~I~~g~~~~~~~~~~~a 86 (1154)
||+|..|+|.|||||.|.++||||..||+|||||||||||+||||.||||.+++.+|++.+.|||| |. +..+
T Consensus 1 ~g~L~~lEieNFKSYkGh~~iGPF~~FTaIIGPNGSGKSNlMDAISFVLGekss~LR~~~lkdLIy-g~-------~i~~ 72 (1141)
T KOG0018|consen 1 MGRLLTLEIENFKSYKGHQVIGPFDRFTAIIGPNGSGKSNLMDAISFVLGEKSSHLRVSHLKDLIY-GK-------PIRK 72 (1141)
T ss_pred CCceeeeehhccccccCceeecCchhceeeeCCCCCchHHHHHHHHHHhcCCCcccccchHHHHhc-CC-------ccCC
Confidence 689999999999999999999999999999999999999999999999999999999999999999 53 2346
Q ss_pred EEEEEEEeCCCceEEEEEEEecCCCeEEEECCccccHHHHHHHHHhcCCccccCeeEEecchhhhhhcCCchHHHHHHHH
Q 036401 87 FVRLVYQLGNESELQFTRTITSSGGSEYRIDGRVVNWDEYNAKLRSLGILVKARNFLVFQGDVESIASKNPKELTALLEQ 166 (1154)
Q Consensus 87 ~v~~~~~~~~~~~~~i~R~i~~~g~s~y~in~~~~~~~~~~~~l~~~~i~~~~~~~~i~Qg~v~~i~~~~p~~~~~~~e~ 166 (1154)
.|++.|.-++|....++|.|+ +|.|+|+|||+.|+..+|...|...||.+.+++|+||||.|+.|+.++|.++..|||+
T Consensus 73 ~v~l~Y~~~dg~~~~F~R~I~-~G~seY~IDne~VT~eeY~~eLekinIlVkARNFLVFQGdVE~IA~k~PkElt~LFEE 151 (1141)
T KOG0018|consen 73 PVTLKYEEGDGETRRFTRAIN-GGTSEYMIDNEIVTREEYLEELEKINILVKARNFLVFQGDVEKIAGKNPKELTALFEE 151 (1141)
T ss_pred chhheeecCCchhhhhhhhhc-CCceeEEEcceeccHHHHHHHHhhcceeeeeeeEEEecChHHHHhccCHHHHHHHHHH
Confidence 677999989999999999999 9999999999999999999999999999999999999999999999999999999999
Q ss_pred hhcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Q 036401 167 ISGSDELKREYEVLEDEKGKAEEKSALVYQKKRTVVLERKQKKEQKEEAERHLRLQDQLKSLKKEHFLWQLFNIEKDITK 246 (1154)
Q Consensus 167 ~~g~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~ei~~lk~~~~~a~~~~~~~~el~~l~~~~~~~~l~~~~~~l~~ 246 (1154)
++|+..|+..|++++.+...+.+........++.|..+...++..+.++++|+.+..+...+...+.+|++++.+..+..
T Consensus 152 ISgSiElK~EYeelK~E~~kAE~~t~~~~~kkk~I~aEkk~aK~~k~eaeky~~lkde~~~~q~e~~L~qLfhvE~~i~k 231 (1141)
T KOG0018|consen 152 ISGSIELKPEYEELKYEMAKAEETTTGNYKKKKSIAAEKKEAKEGKEEAEKYQRLKDEKGKAQKEQFLWELFHVEACIEK 231 (1141)
T ss_pred HhhhhhhhHHHHHHHHHHHHHHHHHhhHhhhhhHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhchhHhhHHHHHHHHHHHHHHHHH
Q 036401 247 ASKDLEAEKRSREEVMRELEHFEDQKRGKRKELAKYLKEIAQCEKKIAERNNRLDKSQPELLKLNEEMSRINSKIKSSKK 326 (1154)
Q Consensus 247 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~~~l~~~~~~~~~~~~~i~~~~~~i~~~~~ 326 (1154)
...++..+..++..+....+..+.++.....+...+..++..++..+...+..+.. +.++-.+.........++...+.
T Consensus 232 ~~~els~~~~ei~~~~~~~d~~e~ei~~~k~e~~ki~re~~~~Dk~i~~ke~~l~e-rp~li~~ke~~~~~k~rl~~~~k 310 (1141)
T KOG0018|consen 232 ANDELSRLNAEIPKLKERMDKKEREIRVRKKERGKIRRELQKVDKKISEKEEKLAE-RPELIKVKENASHLKKRLEEIEK 310 (1141)
T ss_pred hhHHHHHHhhhhHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh-hhHHhhcchhhccchhHHHHhhh
Confidence 99999999999999999999999999888888888889999999999988888888 77788888888888899999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhhcccC----CCCCchhhHHHHHHHHHHHhhhhHHHHHHHHHHH
Q 036401 327 ELERKREERRKHANDIKELQKGIQDLTGKLEELNEKSRDGAG----RLPLLDTQLTEYFQIKEEAGMKTAKLRDEKEVLD 402 (1154)
Q Consensus 327 ~~~~l~~~~~~~~~~l~~l~~~l~~l~~~~~~~~~~~~~~~~----~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~ 402 (1154)
.+...+.........+..+++++..+......+..+++.... .+.+.+...++|..+..++..+. ..++..+.
T Consensus 311 ~i~~~kk~~~~~~~~ie~~ek~l~av~~~~~~fekei~~~~q~rg~~lnl~d~~~~ey~rlk~ea~~~~---~~el~~ln 387 (1141)
T KOG0018|consen 311 DIETAKKDYRALKETIERLEKELKAVEGAKEEFEKEIEERSQERGSELNLKDDQVEEYERLKEEACKEA---LEELEVLN 387 (1141)
T ss_pred hHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCCcchHHHHHHHHHHHHHhhhh---HHHHHHHH
Confidence 999999999999999999999999988888888887765533 34566777888888887665443 77788888
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 036401 403 REQHADLEVLKNLEANLQQLSNREHELDAQEDQMRKRQKNILDASGGHKDELTKLKKELRSMQDKHRDSRQKYENLKSKI 482 (1154)
Q Consensus 403 ~~~~~~~~~~~~l~~~i~~~~~~~~~l~~~~~~l~~~~~~l~~~l~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~l~~~l 482 (1154)
......+..+..+......++.++..+...+.++......+...+..+...+..+...+..++........+...++.+|
T Consensus 388 ~~~r~~~~~ld~~~~~~~elE~r~k~l~~sver~~~~~~~L~~~i~s~~~~~~e~~~d~~~l~~~~~~~~~~~~e~n~eL 467 (1141)
T KOG0018|consen 388 RNMRSDQDTLDHELERRAELEARIKQLKESVERLDKRRNKLAAKITSLSRSYEELKHDLDSLESLVSSAEEEPYELNEEL 467 (1141)
T ss_pred HHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcHHHHHHHHhhhhhhHHHHHHHH
Confidence 88888888888888888888888888888888888888888888888888888888888899998888889999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCcceecccccccCchhHHHHHHHhhccCCCeEEecChhhHHHHHH
Q 036401 483 GEIENQLRELKADRHENERDAKLSQAVETLKRLFQGVHGRMTDLCRPTQKKYNLAVTVAMGKFMDAVVVEDENTGKECIK 562 (1154)
Q Consensus 483 ~~l~~~l~~l~~~~~~~~~~~~~~~~l~~l~~~~~gv~g~l~~l~~~~~~~~~~av~~~lG~~l~~iVvd~~~~a~~~i~ 562 (1154)
.....++..+........+......++..++.+||||+|+|.|||.|...+|..|+.+++|.++++||||+..+|..||.
T Consensus 468 ~~~~~ql~das~dr~e~sR~~~~~eave~lKr~fPgv~GrviDLc~pt~kkyeiAvt~~Lgk~~daIiVdte~ta~~CI~ 547 (1141)
T KOG0018|consen 468 VEVLDQLLDASADRHEGSRRSRKQEAVEALKRLFPGVYGRVIDLCQPTQKKYEIAVTVVLGKNMDAIIVDTEATARDCIQ 547 (1141)
T ss_pred HHHHHHHHhhhhhhcccHHHHHHHHHHHHHHHhCCCccchhhhcccccHHHHHHHHHHHHhcccceEEeccHHHHHHHHH
Confidence 99999999988887777677788899999999999999999999999888999999999999999999999999999997
Q ss_pred ------------------------------------------------HHHHHhCCeEecCChHHHHhhhcc-CCceeEE
Q 036401 563 ------------------------------------------------AVLFAVGNTLVCDGLDEAKVLSWS-GERFRVV 593 (1154)
Q Consensus 563 ------------------------------------------------ai~~~lg~~lvve~~~~A~~i~~~-~~~~~~V 593 (1154)
|+.|++|+++||++.++|+.++|. +.++++|
T Consensus 548 ylKeqr~~~~TFlPld~i~v~~~~e~lr~~~g~rlv~Dvi~ye~e~eka~~~a~gn~Lvcds~e~Ar~l~y~~~~r~k~v 627 (1141)
T KOG0018|consen 548 YLKEQRLEPMTFLPLDSIRVKPVNEKLRELGGVRLVIDVINYEPEYEKAVQFACGNALVCDSVEDARDLAYGGEIRFKVV 627 (1141)
T ss_pred HHHHhccCCccccchhhhhcCcccccccCcCCeEEEEEecCCCHHHHHHHHHHhccceecCCHHHHHHhhhcccccceEE
Confidence 899999999999999999999995 4568999
Q ss_pred eeCCeEeecCceeeccCCCCcCcccccCCHHHHHHHHHHHHHHHHHHHHHhhhhHHhHHHHHHHhhHHHHHHHHHHHHHH
Q 036401 594 TVDGILLTKAGTMTGGTTGGMEARSKQWDDKKIEGLKRKKEQYESELEELGSIREMQLRESETSGKISGLEKKIQYAEIE 673 (1154)
Q Consensus 594 tl~G~~~~~~G~~tgg~~~~~~~~~~~~~~~~i~~l~~~~~~l~~~l~~l~~~~~~~~~~~~l~~~i~~l~~~l~~l~~e 673 (1154)
|+||++++.+|.||||+++ .. |+...++.|....+.+..++.++.. .. ...+..+..+..++..+.....+
T Consensus 628 aldGtl~~ksGlmsGG~s~-----~~-wdek~~~~L~~~k~rl~eel~ei~~-~~--~e~~~v~~~i~~le~~~~~~~~~ 698 (1141)
T KOG0018|consen 628 ALDGTLIHKSGLMSGGSSG-----AK-WDEKEVDQLKEKKERLLEELKEIQK-RR--KEVSSVESKIHGLEMRLKYSKLD 698 (1141)
T ss_pred EeeeeEEeccceecCCccC-----CC-cCHHHHHHHHHHHHHHHHHHHHHHH-hh--hhHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999885 23 9999999999999999999999887 22 26778888999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhhCCcchHHHHHHHHHH
Q 036401 674 KRSIEDKLANLRQEKRTIKEEIGRIKPDLQKLKDKIDRRTTDINKLERRINEITDRLYRDFSESVGVANIREYEENQLKA 753 (1154)
Q Consensus 674 l~~l~~~l~~l~~el~~~~~~l~~~~~~l~~~~~~i~~l~~~i~~l~~~i~~l~~~~~~~~~~~~~~~~~~~~e~~~~~~ 753 (1154)
+..+...+.....++......+..+..++..+...+...+..+++|+.+.+.+++.+|.+||..+++. +.+|++...
T Consensus 699 ~~~~k~~l~~~~~El~~~~~~i~~~~p~i~~i~r~l~~~e~~~~~L~~~~n~ved~if~~f~~~igv~-ir~Yee~~~-- 775 (1141)
T KOG0018|consen 699 LEQLKRSLEQNELELQRTESEIDEFGPEISEIKRKLQNREGEMKELEERMNKVEDRIFKGFCRRIGVR-IREYEEREL-- 775 (1141)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCee-eehHHHHHH--
Confidence 99999999999999999999999999999999999999999999999999999999999999999997 999998775
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHH
Q 036401 754 AQNVAEERLNLSNQLAKLKYQLEYEQKRDVESRIKKLESSLSTLENDLKQVKKKEGDVKSATETATGDITRWKEEMRGWK 833 (1154)
Q Consensus 754 ~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~l~~~~ 833 (1154)
.+.....+.++..++..++.++.+..-++...+++.++..+.+++.+++.++.....+...+..+ .+++. .. .
T Consensus 776 ~~~~a~k~~ef~~q~~~l~~~l~fe~~~d~~~~ve~~~~~v~~~~~~~~~~~~~e~~~~k~i~e~-~~~e~-----k~-k 848 (1141)
T KOG0018|consen 776 QQEFAKKRLEFENQKAKLENQLDFEKQKDTQRRVERWERSVEDLEKEIEGLKKDEEAAEKIIAEI-EELEK-----KN-K 848 (1141)
T ss_pred HHHHHHHHHHHHHHHHHHhhhhhheecccHHHHHHHHHHHHHHHHHhHHhhHHHHHHHHHHHhhH-HHHHH-----HH-H
Confidence 66667778899999999999988886678888899999999999888888888777777666666 44443 11 5
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccCCCCCCCCCCCCCCCCCCCCc
Q 036401 834 SNSDECEKEIQEWEKQASAATTSLSKLNRQINSKEAQIEQLISRKQEIMEKCELECIVLPTVEDPMETDSSSPGPVFDFS 913 (1154)
Q Consensus 834 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~ 913 (1154)
........++.+....+..+.+++..+..++..++..++++..++.+++..|.+++|.+|+..+++++... ...+||+
T Consensus 849 ~~~~~~~~e~~e~~k~~~~~~~~~tkl~~~i~~~es~ie~~~~er~~lL~~ckl~~I~vPl~~gs~~d~~~--~ieidy~ 926 (1141)
T KOG0018|consen 849 SKFEKKEDEINEVKKILRRLVKELTKLDKEITSIESKIERKESERHNLLSKCKLEDIEVPLSSGSMDDIVI--GIEIDYS 926 (1141)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhHHHHHHHHHHHHHHHhhhccccccccCCCccccce--ecccccc
Confidence 66777888899999999999999999999999999999999999999999999999999998776643211 4578999
Q ss_pred ccchhhhhcCchhHHhhhHHHHHHHHHHHHHHHhhcCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 036401 914 QLNRSYLQERRPSEREKLEVEFKQKMDALISEIEKTAPNLKALDQYEALLEKERTVTEEFEAARKEEKQAADAYNSVKQK 993 (1154)
Q Consensus 914 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~i~~l~~n~~a~e~~~~~~~~~~~~~~~~~~l~~~~~~~~~~i~~~~~~ 993 (1154)
.||..|. ++.+|.+....|+++.||++|++.|+.++ +..+..+++.+++....+...|+.++.+
T Consensus 927 ~L~~~y~--------------L~~kl~e~~~~l~~~~Pn~kA~~~~d~v~--~~~~~~EfE~ark~ak~ak~~F~~VK~~ 990 (1141)
T KOG0018|consen 927 GLPREYK--------------LQQKLEEKQSVLNRIAPNLKALERLDEVR--FQEINEEFEAARKEAKKAKNAFNKVKKK 990 (1141)
T ss_pred cccHHHH--------------HHHHHHHHHHHHHHhCcchHHHhhhhhHH--HHHhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9998763 78899999999999999999999999998 9999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCceEEEeccCCCCCCCcccceeecCCCCcccccccCchhhHHHHHHHHH
Q 036401 994 RYGLFMEAFNHISSSIDRIYKQLTRSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALL 1073 (1154)
Q Consensus 994 ~~~~f~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lSgGek~~~~la~~ 1073 (1154)
|..+|+.||++|+.++..+|..|| |. .|.|+|.++++++||.+||.|.++||+|+|+++.+||||||+++||||+
T Consensus 991 R~~~F~~~F~~va~~Id~IYK~Lt---nt--~g~AyL~~en~~EPyl~GIky~~~pP~KRFr~m~~LSGGEKTvAaLALL 1065 (1141)
T KOG0018|consen 991 RYERFMACFEHVADNIDRIYKELT---NT--EGQAYLGLENPEEPYLDGIKYHCMPPGKRFRPMDNLSGGEKTVAALALL 1065 (1141)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHhc---cc--ccceeecCCCCCcchhcCccccccCCccccCchhhcCccHHHHHHHHHH
Confidence 999999999999999999999998 22 4899999999999999999999999999999999999999999999999
Q ss_pred HhhcccCCCCeEEeeccccccchhhHHHHHHHHHhcccCCCCCCCCCCCCCCeeEEEEEechhHHHhccceEEEeecCC
Q 036401 1074 FSIHSYKPSPFFILDEVDAALDNLNVAKVAGFIRSKSCEGTRGNQDADEGNGFQSIVISLKDSFYDKAEALVGVYRDSD 1152 (1154)
Q Consensus 1074 ~a~~~~~p~~~~~lDE~d~~lD~~~~~~~~~~l~~~~~~~~~~~~~a~~~~~~q~i~it~~~~~~~~~d~~~GV~~~~~ 1152 (1154)
||+|.|+||||+||||+|||||..|+.+|+.||+ - ++.||||||.++.+|..||.|+|||.+++
T Consensus 1066 Faihsy~PaPFfvlDEiDAALDntNi~kvasyIr-~--------------~~~Q~IvISLK~~~y~kadaLVGvyr~~~ 1129 (1141)
T KOG0018|consen 1066 FAIHSYKPAPFFVLDEIDAALDNTNIGKVASYIR-S--------------SNFQFIVISLKEEFYQKADALVGVYRDQE 1129 (1141)
T ss_pred HHhccCCCCCceehhhHHHHhhhccHHHHHHHHh-c--------------CCceEEEEeccHHHhhhhhceeeeccCcc
Confidence 9999999999999999999999999999999999 2 58999999999999999999999999854
|
|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PF06470 SMC_hinge: SMC proteins Flexible Hinge Domain; InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PF11398 DUF2813: Protein of unknown function (DUF2813); InterPro: IPR022602 This entry contains YbjD from Escherichia coli (strain K12), which is a conserved protein with a nucleotide triphosphate binding domain | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >COG1106 Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >COG4694 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1154 | ||||
| 1w1w_A | 430 | Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 | 3e-45 | ||
| 2wd5_A | 233 | Smc Hinge Heterodimer (Mouse) Length = 233 | 7e-24 | ||
| 1xew_Y | 172 | Structural Biochemistry Of Atp-Driven Dimerization | 2e-23 | ||
| 1xex_B | 172 | Structural Biochemistry Of Atp-Driven Dimerization | 5e-23 | ||
| 3kta_B | 173 | Structural Basis For Adenylate Kinase Activity In A | 7e-22 | ||
| 4i99_A | 354 | Crystal Structure Of The Smchead Bound To The C-win | 5e-21 | ||
| 3zgx_A | 426 | Crystal Structure Of The Kleisin-n Smc Interface In | 1e-19 | ||
| 1xew_X | 182 | Structural Biochemistry Of Atp-Driven Dimerization | 4e-15 | ||
| 3kta_A | 182 | Structural Basis For Adenylate Kinase Activity In A | 9e-15 | ||
| 1e69_A | 322 | Smc Head Domain From Thermotoga Maritima Length = 3 | 1e-12 | ||
| 1e69_A | 322 | Smc Head Domain From Thermotoga Maritima Length = 3 | 2e-10 | ||
| 3nwc_A | 189 | Crystal Structure Of The Pyrococcus Furiosus Smc Pr | 4e-05 |
| >pdb|1W1W|A Chain A, Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 | Back alignment and structure |
|
| >pdb|2WD5|A Chain A, Smc Hinge Heterodimer (Mouse) Length = 233 | Back alignment and structure |
| >pdb|1XEW|Y Chain Y, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172 | Back alignment and structure |
| >pdb|1XEX|B Chain B, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172 | Back alignment and structure |
| >pdb|3KTA|B Chain B, Structural Basis For Adenylate Kinase Activity In Abc Atpases Length = 173 | Back alignment and structure |
| >pdb|4I99|A Chain A, Crystal Structure Of The Smchead Bound To The C-winged Helix Domain Of Scpa Length = 354 | Back alignment and structure |
| >pdb|3ZGX|A Chain A, Crystal Structure Of The Kleisin-n Smc Interface In Prokaryotic Condensin Length = 426 | Back alignment and structure |
| >pdb|1XEW|X Chain X, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases. Length = 182 | Back alignment and structure |
| >pdb|3KTA|A Chain A, Structural Basis For Adenylate Kinase Activity In Abc Atpases Length = 182 | Back alignment and structure |
| >pdb|1E69|A Chain A, Smc Head Domain From Thermotoga Maritima Length = 322 | Back alignment and structure |
| >pdb|1E69|A Chain A, Smc Head Domain From Thermotoga Maritima Length = 322 | Back alignment and structure |
| >pdb|3NWC|A Chain A, Crystal Structure Of The Pyrococcus Furiosus Smc Protein Hinge Domain Length = 189 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
Score = 248 bits (635), Expect = 7e-73
Identities = 102/299 (34%), Positives = 154/299 (51%), Gaps = 19/299 (6%)
Query: 862 RQINSKEAQIEQLISRKQEIMEKCELECIVLPTVEDP----METDSSSPGPVFDFSQLNR 917
+ + LI K ++ + ++E I + + E S +
Sbjct: 129 KDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQYKKEYEELKEK 188
Query: 918 SYLQERRPSEREKLEVEFKQKMDALISEIEKTAPNLKALDQYEALLEKERTVTEEFEAAR 977
+ +E K ++ S + +Y+ + + E E +
Sbjct: 189 IEKLSKSATESIKNRRRIHGELKTYKSPGLEVLFQGPRGSRYDEAEGRFEVINNETEQLK 248
Query: 978 KEEKQAADAYNSVKQKRYGLFMEAFNHISSSIDRIYKQLTRSNTHPL---GGTAYLNLEN 1034
EEK+ + + +K+KR LF + F+++S +D IY++LT++ + GG A L +E+
Sbjct: 249 AEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIED 308
Query: 1035 EDDPFLHGIKYTAMPPTKRFRDMEQLSGGEKTVAALALLFSIHSYKPSPFFILDEVDAAL 1094
ED+PF GIKY A PP KRF+DME LSGGEKTVAALALLF+I+SY+PSPFF+LDEVDAAL
Sbjct: 309 EDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAAL 368
Query: 1095 DNLNVAKVAGFIRSKSCEGTRGNQDADEGNGFQSIVISLKDSFYDKAEALVGVYRDSDR 1153
D NV ++A +IR Q IVISLK++ ++K++ALVGVYR
Sbjct: 369 DITNVQRIAAYIRRHRNPDL------------QFIVISLKNTMFEKSDALVGVYRQQQE 415
|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 233 | Back alignment and structure |
|---|
| >3nwc_A SMC protein; structural maintenance of chromosomes (SMC), SMC hinge domai dimerization, DNA binding, cell cycle; 1.70A {Pyrococcus furiosus} Length = 189 | Back alignment and structure |
|---|
| >1gxl_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 3.0A {Thermotoga maritima} SCOP: d.215.1.1 Length = 213 | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Length = 173 | Back alignment and structure |
|---|
| >1gxj_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 2.0A {Thermotoga maritima} SCOP: d.215.1.1 PDB: 1gxk_A Length = 186 | Back alignment and structure |
|---|
| >3l51_B Structural maintenance of chromosomes protein 4; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} Length = 166 | Back alignment and structure |
|---|
| >3l51_A Structural maintenance of chromosomes protein 2; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} Length = 161 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Length = 182 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >2wd5_B Structural maintenance of chromosomes protein 3; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 213 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Length = 149 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Length = 359 | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Length = 227 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Length = 483 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1154 | |||
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 100.0 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 99.97 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 99.96 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 99.94 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.93 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.9 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.89 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.87 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.82 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 99.71 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.66 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 99.65 | |
| 2wd5_A | 233 | Structural maintenance of chromosomes protein 1A; | 99.63 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.61 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.61 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.6 | |
| 3l51_B | 166 | Structural maintenance of chromosomes protein 4; s | 99.59 | |
| 3nwc_A | 189 | SMC protein; structural maintenance of chromosomes | 99.54 | |
| 3l51_A | 161 | Structural maintenance of chromosomes protein 2; s | 99.54 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.51 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.48 | |
| 2wd5_B | 213 | Structural maintenance of chromosomes protein 3; D | 99.45 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.44 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.44 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.43 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.43 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.43 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.43 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.43 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.42 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.42 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.42 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.42 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.42 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.42 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.42 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.42 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.41 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.41 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.39 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.39 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.39 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.39 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.39 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.39 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.38 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.38 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.38 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.38 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.37 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.37 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.37 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.37 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.36 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.36 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.36 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.35 | |
| 1gxl_A | 213 | SMC, chromosome segregation SMC protein; SMC dimer | 99.35 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.34 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.3 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.3 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.3 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.21 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.19 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.19 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.18 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.18 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.17 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.17 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.17 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.17 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.16 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.16 | |
| 1gxj_A | 186 | SMC, chromosome segregation SMC protein; SMC dimer | 99.15 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.14 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.13 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.13 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.11 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.1 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.09 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.09 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.06 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.05 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.04 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.03 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.03 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 99.01 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.0 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 98.99 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 98.99 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.97 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 98.97 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.95 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 98.94 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 98.93 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.87 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 98.8 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.74 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 98.71 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 98.46 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 98.05 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 97.99 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 97.99 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.96 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 97.91 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.9 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 97.86 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 97.84 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 97.83 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 97.79 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 97.75 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 97.75 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 97.75 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 97.72 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 97.71 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 97.66 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 97.63 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 97.61 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 97.6 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 97.6 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 97.59 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 97.59 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 97.56 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 97.52 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 97.52 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 97.51 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.49 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 97.47 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.47 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 97.45 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 97.44 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 97.44 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 97.44 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.44 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 97.43 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.42 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.4 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 97.39 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 97.39 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 97.39 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.38 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 97.37 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 97.36 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 97.34 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.33 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.27 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 97.27 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 97.27 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.26 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 97.26 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.23 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 97.22 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.18 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.11 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 97.11 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 97.08 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.08 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 97.07 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.02 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 97.02 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.0 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 96.99 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.98 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 96.95 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 96.94 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.89 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 96.88 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 96.86 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.83 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.8 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 96.8 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 96.79 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.76 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 96.74 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 96.73 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 96.68 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 96.66 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.66 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.62 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.61 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.61 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.61 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.6 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.59 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 96.58 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.58 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 96.53 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.53 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 96.49 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.49 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 96.47 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 96.4 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 96.39 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.39 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.39 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.36 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 96.35 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.34 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.31 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.31 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.31 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.29 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.24 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.23 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.19 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 96.18 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.16 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 96.14 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 96.11 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.1 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.1 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 96.08 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.07 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 96.0 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 95.99 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 95.99 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 95.97 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 95.97 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 95.95 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.94 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.94 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.93 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 95.92 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.92 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 95.92 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 95.91 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 95.91 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 95.9 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 95.89 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 95.89 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.88 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 95.85 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 95.82 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 95.74 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 95.74 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 95.72 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.71 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.7 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 95.64 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 95.62 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 95.6 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 95.6 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 95.57 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 95.57 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 95.56 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 95.48 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 95.46 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.46 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 95.46 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 95.42 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 95.34 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.32 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 95.31 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 95.27 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 95.25 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 95.25 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 95.24 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 95.23 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.2 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.13 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 95.12 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 95.1 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.09 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 95.09 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.08 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.06 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 95.0 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 95.0 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 94.99 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.94 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.93 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 94.87 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 94.85 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 94.81 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 94.77 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 94.76 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 94.75 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 94.74 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 94.69 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 94.66 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 94.61 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.59 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 94.58 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.5 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 94.45 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.42 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 94.33 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 94.3 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 94.28 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.27 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 94.24 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.24 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.22 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 94.18 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.12 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 94.07 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.05 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 94.03 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 93.96 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 93.84 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.83 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 93.82 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 93.75 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 93.75 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 93.75 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 93.73 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 93.72 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 93.68 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 93.65 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 93.63 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 93.63 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 93.55 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 93.53 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 93.52 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 93.46 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 93.44 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 93.42 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 93.4 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 93.34 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 93.3 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 93.29 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.25 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 93.23 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 93.21 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 93.16 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 93.14 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 93.13 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 93.1 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 93.08 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 93.07 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.07 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 92.76 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 92.68 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 92.68 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.63 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 92.59 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 92.52 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 92.4 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.4 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 92.38 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 92.37 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.36 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 92.31 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 92.18 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 92.17 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 92.11 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 92.1 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 92.08 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 92.08 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 92.06 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 92.06 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 92.05 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 92.04 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 92.03 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 91.99 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 91.97 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 91.95 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 91.94 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 91.91 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 91.9 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 91.89 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 91.89 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 91.73 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 91.71 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 91.49 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 91.48 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 91.41 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 91.41 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 91.41 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 91.37 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 91.27 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 91.24 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.24 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 91.21 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 91.19 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 91.13 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 91.1 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 91.09 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 91.07 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 91.04 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 90.98 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 90.92 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 90.92 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 90.83 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 90.81 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 90.8 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 90.79 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 90.75 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 90.75 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 90.66 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 90.64 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 90.58 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 90.58 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 90.54 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 90.39 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 90.38 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 90.37 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 90.36 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 90.34 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 90.29 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 90.27 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 90.25 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 90.22 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 90.19 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 90.12 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 90.1 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 89.95 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 89.93 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 89.92 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 89.89 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 89.88 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 89.86 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 89.83 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 89.77 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 89.72 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 89.7 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 89.69 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 89.69 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 89.66 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 89.63 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 89.61 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 89.6 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 89.6 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 89.59 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 89.58 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 89.56 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 89.54 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 89.54 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 89.53 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 89.52 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 89.5 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 89.4 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 89.33 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 89.3 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 89.3 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 89.29 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 89.23 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 89.13 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 89.07 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 89.06 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 89.06 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 89.04 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 89.0 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 88.98 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 88.97 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 88.93 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 88.92 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 88.84 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 88.83 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 88.8 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 88.78 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 88.76 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 88.75 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 88.7 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 88.7 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 88.65 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 88.6 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 88.57 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 88.54 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 88.52 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 88.5 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 88.5 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 88.5 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 88.46 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 88.43 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 88.42 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 88.38 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 88.32 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 88.31 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 88.25 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 88.22 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 88.21 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 88.14 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 88.11 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 88.11 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 88.09 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 88.03 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 88.03 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 88.03 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 88.02 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 88.02 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 88.0 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 87.93 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 87.88 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 87.85 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 87.85 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 87.81 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 87.8 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 87.79 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 87.66 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 87.65 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 87.63 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 87.6 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 87.56 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 87.54 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 87.44 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 87.4 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 87.39 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 87.27 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 87.26 |
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
Probab=100.00 E-value=6.8e-38 Score=362.66 Aligned_cols=170 Identities=49% Similarity=0.833 Sum_probs=126.4
Q ss_pred CCceeEEEEecceeccCceeecCC-CCeEEEEcCCCCCHHHHHHHHHHHhCcccccccccccchhhhcccchhh------
Q 036401 7 PGKIHRLELENFKSYKGLQIIGPF-SDFTAIIGPNGAGKSNLMDAISFVLGVRTGQLRGGQLKDLIYAYDDKEK------ 79 (1154)
Q Consensus 7 ~~~i~~l~l~nFks~~~~~~i~~~-~~~~~IvG~NGsGKS~ildAi~~~lg~~~~~~r~~~~~~~I~~g~~~~~------ 79 (1154)
||+|++|.+.||++|.+.+.+.|. +++|+|+||||||||||++||+|++++.+..+|+..+.|+|+.|.....
T Consensus 1 mm~i~~l~~~~~~~~~~~~~~~~~~~~~~~i~G~nG~GKstll~ai~~~~~~~~~~~R~~~~~~lI~~g~~~~~~~~~~~ 80 (430)
T 1w1w_A 1 MGRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLNDENSDDYD 80 (430)
T ss_dssp -CCEEEEEEESCSSCCSEEEEECTTCSEEEEECSTTSSHHHHHHHHHHHTTC---------CGGGSCCC-----------
T ss_pred CCeeEEEEEeCEEEECCceeEEecCCCEEEEECCCCCCHHHHHHHHHhhhccccccchhhhHHHHHhcCCccceeeEEec
Confidence 589999999999999886656554 4699999999999999999999999987766899999999999862110
Q ss_pred -----hcccceEEEEEEEEeCCCceEEEEEEEecCCCeEEEECCccccHHHHHHHHHhcCCccccCeeEEecchhhhhhc
Q 036401 80 -----EQKGRRAFVRLVYQLGNESELQFTRTITSSGGSEYRIDGRVVNWDEYNAKLRSLGILVKARNFLVFQGDVESIAS 154 (1154)
Q Consensus 80 -----~~~~~~a~v~~~~~~~~~~~~~i~R~i~~~g~s~y~in~~~~~~~~~~~~l~~~~i~~~~~~~~i~Qg~v~~i~~ 154 (1154)
...+..++|...|... +..+.|.|.+.++|.+.|+|||++++.+++..++...||.+.+.+|+++||++..|+.
T Consensus 81 ~~~~~~~~~~~~~v~~~~~~~-~~~~~i~r~~~~~~~~~~~ing~~~~~~~~~~~~~~~~i~~~~~~~~i~qg~~~~l~~ 159 (430)
T 1w1w_A 81 NEGAASSNPQSAYVKAFYQKG-NKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAA 159 (430)
T ss_dssp --------CCEEEEEEEEEET-TEEEEEEEEEETTSCEEEEETTEEECHHHHHHHHHHTTCCTTTCTTEECTTCTTHHHH
T ss_pred ccccccCCcccccceeeeccC-CcEEEEEEEEecCCceEEEECCEEccHHHHHHHHHhCCcCCCCcceeeehHhHHHHHh
Confidence 0012578999999764 5689999999988889999999999999999999888988877888999999999999
Q ss_pred CCchHHHHHHHHhhcchhhhHHH
Q 036401 155 KNPKELTALLEQISGSDELKREY 177 (1154)
Q Consensus 155 ~~p~~~~~~~e~~~g~~~~~~~~ 177 (1154)
++|.+|+.+|++++|+..|...|
T Consensus 160 ~~p~eRr~~ld~~~g~~~~~~~~ 182 (430)
T 1w1w_A 160 QSPVELSRMFEEVSGSIQYKKEY 182 (430)
T ss_dssp SCHHHHHHTC-------------
T ss_pred CCHHHHHHHHHHHhCchhHHHHH
Confidence 99999999999999987776443
|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3l51_B Structural maintenance of chromosomes protein 4; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} SCOP: d.215.1.0 | Back alignment and structure |
|---|
| >3nwc_A SMC protein; structural maintenance of chromosomes (SMC), SMC hinge domai dimerization, DNA binding, cell cycle; 1.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3l51_A Structural maintenance of chromosomes protein 2; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2wd5_B Structural maintenance of chromosomes protein 3; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1gxl_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 3.0A {Thermotoga maritima} SCOP: d.215.1.1 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gxj_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 2.0A {Thermotoga maritima} SCOP: d.215.1.1 PDB: 1gxk_A | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1154 | ||||
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 1e-30 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 5e-28 | |
| d1e69a_ | 308 | c.37.1.12 (A:) Smc head domain {Thermotoga maritim | 8e-27 | |
| d1e69a_ | 308 | c.37.1.12 (A:) Smc head domain {Thermotoga maritim | 2e-09 | |
| g1xew.1 | 329 | c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi | 6e-24 | |
| g1xew.1 | 329 | c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi | 2e-15 | |
| d1gxja_ | 161 | d.215.1.1 (A:) Smc hinge domain {Thermotoga mariti | 2e-20 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 6e-16 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 5e-06 | |
| d1qhla_ | 222 | c.37.1.12 (A:) Cell division protein MukB {Escheri | 2e-13 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-11 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 1e-04 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 4e-04 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 7e-04 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 0.002 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 0.004 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 0.004 |
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Smc head domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 124 bits (310), Expect = 1e-30
Identities = 75/162 (46%), Positives = 107/162 (66%), Gaps = 13/162 (8%)
Query: 8 GKIHRLELENFKSYKGLQIIGPFSD-FTAIIGPNGAGKSNLMDAISFVLGVRTGQLRGGQ 66
G++ LEL NFKSY+G+ +G FT+IIGPNG+GKSN+MDAISFVLGVR+ LR
Sbjct: 1 GRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNI 60
Query: 67 LKDLIYAYDDKEK-----------EQKGRRAFVRLVYQLGNESELQFTRTITSSGGSEYR 115
LKDLIY ++ + A+V+ YQ GN+ ++ R I+ +G + Y+
Sbjct: 61 LKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNK-LVELMRIISRNGDTSYK 119
Query: 116 IDGRVVNWDEYNAKLRSLGILVKARNFLVFQGDVESIASKNP 157
IDG+ V++ +Y+ L + IL+KA+NFLVFQGDVE IA+++P
Sbjct: 120 IDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 161
|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Length = 222 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1154 | |||
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 100.0 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 99.9 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 99.89 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.67 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.66 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.57 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.56 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.56 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.55 | |
| d1gxja_ | 161 | Smc hinge domain {Thermotoga maritima [TaxId: 2336 | 99.55 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.55 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.54 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 99.54 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.54 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.54 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.54 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.54 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.53 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.52 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.52 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.52 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 99.51 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.5 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.48 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.47 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.47 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 99.43 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.4 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.39 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.38 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.21 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 98.1 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 98.09 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 97.91 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 97.87 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 97.87 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 97.8 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.79 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.78 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.7 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.67 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.67 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.61 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.61 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 97.53 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.43 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.29 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.23 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 97.2 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.15 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.07 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 97.02 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.48 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.93 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 95.77 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.7 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.69 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.43 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.25 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.23 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 95.22 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.21 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.12 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.08 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 94.96 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.96 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.9 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.87 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.8 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.75 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 94.69 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.62 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.61 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 94.6 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 94.5 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 94.43 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.34 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 94.31 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.31 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 94.19 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 93.85 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 93.84 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 93.83 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.75 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 93.68 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.61 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 93.54 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.24 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 93.22 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 93.15 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.15 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 93.13 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 93.02 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 92.94 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 92.92 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 92.9 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 92.87 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 92.79 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 92.77 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.57 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 92.45 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 92.44 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 92.37 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.37 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 92.31 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 92.26 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 92.16 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 92.16 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.85 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 91.82 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 91.7 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 91.66 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 91.58 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 91.56 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 91.54 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 91.54 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 91.51 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 91.5 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 91.45 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 91.44 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.44 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 91.41 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 91.4 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 91.36 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 91.35 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 91.28 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 91.28 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 91.27 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 91.26 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 91.22 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 91.11 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.99 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 90.9 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 90.84 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 90.83 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.83 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 90.79 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 90.55 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 90.52 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 90.27 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 90.22 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.2 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.16 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 90.12 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 90.04 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.02 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 89.96 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 89.92 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 89.9 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 89.89 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 89.8 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.78 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 89.65 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 89.65 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 89.58 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 89.52 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 89.27 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 89.2 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 89.14 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 89.13 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 89.12 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 89.0 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 88.98 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 88.95 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 88.92 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 88.86 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 88.81 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 88.78 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 88.73 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 88.55 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 88.47 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 88.26 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 87.96 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 87.92 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 87.42 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 87.37 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 87.28 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.09 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 87.07 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 87.03 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 87.03 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 86.8 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 86.7 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 86.58 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 86.55 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 86.53 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 86.43 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 86.33 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 86.27 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 86.26 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 86.22 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 86.1 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 86.03 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 85.9 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 85.85 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 85.84 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 85.68 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 85.62 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 85.53 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 85.49 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 85.45 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 85.34 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 85.26 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 85.21 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 85.03 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 84.84 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 84.76 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 84.75 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 84.71 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 84.5 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 84.4 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 84.18 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 84.15 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 84.14 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 83.89 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 83.86 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 83.74 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 83.68 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 83.66 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 83.62 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 83.57 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 83.49 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 83.45 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 83.43 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 83.32 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 82.93 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 82.9 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 82.88 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 82.86 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 82.84 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 82.8 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 82.78 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 82.74 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 82.66 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 82.56 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 82.38 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 82.26 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 82.06 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 81.97 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 81.77 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 81.69 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 81.14 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 81.09 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 80.91 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 80.79 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 80.61 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 80.34 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 80.06 |
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Smc head domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=6.3e-41 Score=390.88 Aligned_cols=165 Identities=49% Similarity=0.828 Sum_probs=129.3
Q ss_pred CceeEEEEecceeccCceeecCC-CCeEEEEcCCCCCHHHHHHHHHHHhCcccccccccccchhhhcccchhh-------
Q 036401 8 GKIHRLELENFKSYKGLQIIGPF-SDFTAIIGPNGAGKSNLMDAISFVLGVRTGQLRGGQLKDLIYAYDDKEK------- 79 (1154)
Q Consensus 8 ~~i~~l~l~nFks~~~~~~i~~~-~~~~~IvG~NGsGKS~ildAi~~~lg~~~~~~r~~~~~~~I~~g~~~~~------- 79 (1154)
|+|++|.|.|||||.+.+.|.|+ +|||+|+|||||||||||+||+||||.++..+|++++.|+||+|.....
T Consensus 1 ~ki~~l~l~NFks~~~~~~i~f~~~~l~~i~G~NGsGKS~ileAi~~~lg~~~~~~R~~~~~dli~~g~~~~~~~~~~~~ 80 (427)
T d1w1wa_ 1 GRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLNDENSDDYDN 80 (427)
T ss_dssp CCEEEEEEESCSSCCSEEEEECTTCSEEEEECSTTSSHHHHHHHHHHHTTC---------CGGGSCCC------------
T ss_pred CeEEEEEEeCeeeeCCCEEEeCCCCCEEEEECCCCCCHHHHHHHHHHHhCCCccccccccchhheecCCcCCcceEEEEe
Confidence 89999999999999988878665 5799999999999999999999999998877999999999999853211
Q ss_pred ----hcccceEEEEEEEEeCCCceEEEEEEEecCCCeEEEECCccccHHHHHHHHHhcCCccccCeeEEecchhhhhhcC
Q 036401 80 ----EQKGRRAFVRLVYQLGNESELQFTRTITSSGGSEYRIDGRVVNWDEYNAKLRSLGILVKARNFLVFQGDVESIASK 155 (1154)
Q Consensus 80 ----~~~~~~a~v~~~~~~~~~~~~~i~R~i~~~g~s~y~in~~~~~~~~~~~~l~~~~i~~~~~~~~i~Qg~v~~i~~~ 155 (1154)
......+++.+.|.+. +..+.|+|.+.++|.+.|+|||++|+.+++..++..+|+.+.+++++++||+|+.++.+
T Consensus 81 ~~~~~~~~~~~~~~~~~~~~-~~~i~i~r~i~~~~~~~~~in~~~~~~~~i~~~~~~~~~~~~~~~~~i~q~~~~~~~~~ 159 (427)
T d1w1wa_ 81 EGAASSNPQSAYVKAFYQKG-NKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQ 159 (427)
T ss_dssp -------CCEEEEEEEEEET-TEEEEEEEEEETTSCEEEEETTEEECHHHHHHHHHHTTCCTTTCTTEECTTCTTHHHHS
T ss_pred eccccccccccceeeeeccC-CcEEEEEEEEccCCceeEecCcccccHHHHHHHHHHcCCCCCCccceechhhhhhhhhc
Confidence 2234567788888766 67899999999999999999999999999999999999999999999999999999999
Q ss_pred CchHHHHHHHHhhcchhh
Q 036401 156 NPKELTALLEQISGSDEL 173 (1154)
Q Consensus 156 ~p~~~~~~~e~~~g~~~~ 173 (1154)
+|.+++.+++.++|+..|
T Consensus 160 ~~~~~~~~le~~~~~~~~ 177 (427)
T d1w1wa_ 160 SPVELSRMFEEVSGSIQY 177 (427)
T ss_dssp CHHHHHHTC---------
T ss_pred cccccccccccccccccc
Confidence 999999999998887544
|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|