Citrus Sinensis ID: 036416
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 256 | ||||||
| 42568692 | 406 | NADPH2:quinone reductase [Arabidopsis th | 0.792 | 0.5 | 0.833 | 4e-98 | |
| 9758467 | 324 | quinone oxidoreductase [Arabidopsis thal | 0.734 | 0.580 | 0.877 | 7e-96 | |
| 297797111 | 403 | hypothetical protein ARALYDRAFT_496310 [ | 0.796 | 0.506 | 0.814 | 6e-95 | |
| 224129570 | 324 | predicted protein [Populus trichocarpa] | 0.734 | 0.580 | 0.840 | 1e-91 | |
| 224138152 | 324 | predicted protein [Populus trichocarpa] | 0.734 | 0.580 | 0.861 | 1e-91 | |
| 211905343 | 324 | Ted2 [Gossypium hirsutum] | 0.734 | 0.580 | 0.845 | 2e-91 | |
| 1617036 | 324 | Ted2 [Vigna unguiculata] | 0.734 | 0.580 | 0.845 | 9e-91 | |
| 356544208 | 376 | PREDICTED: quinone oxidoreductase 1-like | 0.742 | 0.505 | 0.826 | 2e-90 | |
| 255539845 | 323 | quinone oxidoreductase, putative [Ricinu | 0.730 | 0.578 | 0.840 | 1e-87 | |
| 359482805 | 395 | PREDICTED: quinone oxidoreductase 1 [Vit | 0.773 | 0.501 | 0.754 | 4e-86 |
| >gi|42568692|ref|NP_200959.2| NADPH2:quinone reductase [Arabidopsis thaliana] gi|119935943|gb|ABM06041.1| At5g61510 [Arabidopsis thaliana] gi|332010094|gb|AED97477.1| NADPH2:quinone reductase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 363 bits (932), Expect = 4e-98, Method: Compositional matrix adjust.
Identities = 170/204 (83%), Positives = 187/204 (91%), Gaps = 1/204 (0%)
Query: 53 KALATKAAAETRTRTNMVKAIRVYEHGDPEVLKWEDVEIGEPGEGEIRVRNKAIGLNFID 112
+AL+T A E+ + MVK IRVYEHG PEVLKWEDVE+GEP EGEIRV+NKAIGLNFID
Sbjct: 68 RALSTVAVEESSEK-KMVKGIRVYEHGGPEVLKWEDVEVGEPKEGEIRVKNKAIGLNFID 126
Query: 113 VYYRKGVYKPAKMPFTPGMEAVGEVVAVGPGLTGRTVGDIIAYAGGAMGSYAEEQILPAN 172
VY+RKGVYKPA MPFTPGMEAVGEVVAVG GLTGR +GD++AYAG MG+YAEEQILPA+
Sbjct: 127 VYFRKGVYKPASMPFTPGMEAVGEVVAVGSGLTGRMIGDLVAYAGNPMGAYAEEQILPAD 186
Query: 173 KVVPVPSSIDPVIAASIMLKGMTAQFLLRRCFKVEPGHTVLIQAAAGGVGSLLCQWANAL 232
KVVPVPSSIDP++AASIMLKGMTAQFLLRRCFKVEPGHT+L+ AAAGGVGSLLCQWANAL
Sbjct: 187 KVVPVPSSIDPIVAASIMLKGMTAQFLLRRCFKVEPGHTILVHAAAGGVGSLLCQWANAL 246
Query: 233 GATVIGTVSTKEKAAQAKDDGCHH 256
GATVIGTVST EKAAQAK+DGCHH
Sbjct: 247 GATVIGTVSTNEKAAQAKEDGCHH 270
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|9758467|dbj|BAB08996.1| quinone oxidoreductase [Arabidopsis thaliana] gi|21618282|gb|AAM67332.1| quinone oxidoreductase-like protein [Arabidopsis thaliana] gi|28393593|gb|AAO42216.1| putative quinone oxidoreductase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297797111|ref|XP_002866440.1| hypothetical protein ARALYDRAFT_496310 [Arabidopsis lyrata subsp. lyrata] gi|297312275|gb|EFH42699.1| hypothetical protein ARALYDRAFT_496310 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224129570|ref|XP_002328749.1| predicted protein [Populus trichocarpa] gi|222839047|gb|EEE77398.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224138152|ref|XP_002326531.1| predicted protein [Populus trichocarpa] gi|222833853|gb|EEE72330.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|211905343|gb|ACJ11251.1| Ted2 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|1617036|emb|CAA69914.1| Ted2 [Vigna unguiculata] | Back alignment and taxonomy information |
|---|
| >gi|356544208|ref|XP_003540546.1| PREDICTED: quinone oxidoreductase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255539845|ref|XP_002510987.1| quinone oxidoreductase, putative [Ricinus communis] gi|223550102|gb|EEF51589.1| quinone oxidoreductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359482805|ref|XP_002271007.2| PREDICTED: quinone oxidoreductase 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 256 | ||||||
| TAIR|locus:2151581 | 406 | AT5G61510 [Arabidopsis thalian | 0.734 | 0.463 | 0.75 | 7.5e-73 | |
| UNIPROTKB|Q4KKQ5 | 325 | qor_2 "NADPH:quinone reductase | 0.710 | 0.56 | 0.461 | 3.7e-39 | |
| UNIPROTKB|Q48QH7 | 325 | qor1 "Quinone oxidoreductase" | 0.710 | 0.56 | 0.467 | 5.5e-38 | |
| TIGR_CMR|SPO_0232 | 327 | SPO_0232 "quinone oxidoreducta | 0.691 | 0.541 | 0.426 | 8.5e-33 | |
| UNIPROTKB|P28304 | 327 | qor [Escherichia coli K-12 (ta | 0.722 | 0.565 | 0.389 | 9.8e-32 | |
| UNIPROTKB|Q4KE80 | 324 | qor_1 "NADPH:quinone reductase | 0.722 | 0.570 | 0.408 | 1.3e-31 | |
| UNIPROTKB|O53146 | 328 | qor "NADPH2:quinone reductase" | 0.703 | 0.548 | 0.419 | 4.4e-29 | |
| UNIPROTKB|Q0BYL8 | 325 | HNE_2746 "Putative quinone oxi | 0.687 | 0.541 | 0.424 | 5e-28 | |
| UNIPROTKB|Q2GL79 | 326 | qor "Quinone oxidoreductase" [ | 0.734 | 0.576 | 0.343 | 1.3e-27 | |
| TIGR_CMR|APH_0257 | 326 | APH_0257 "quinone oxidoreducta | 0.734 | 0.576 | 0.343 | 1.3e-27 |
| TAIR|locus:2151581 AT5G61510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 736 (264.1 bits), Expect = 7.5e-73, P = 7.5e-73
Identities = 141/188 (75%), Positives = 152/188 (80%)
Query: 69 MVKAIRVYEHGDPEVLKWEDVEIGEPGEGEIRVRNKAIGLNFIDVYYRKGVYKPAKMPFT 128
MVK IRVYEHG PEVLKWEDVE+GEP EGEIRV+NKAIGLNFIDVY+RKGVYKPA MPFT
Sbjct: 83 MVKGIRVYEHGGPEVLKWEDVEVGEPKEGEIRVKNKAIGLNFIDVYFRKGVYKPASMPFT 142
Query: 129 XXXXXXXXXXXXXXXLTGRTVGDIIAYAGGAMGSYAEEQILPANKXXXXXXXXXXXXAAS 188
LTGR +GD++AYAG MG+YAEEQILPA+K AAS
Sbjct: 143 PGMEAVGEVVAVGSGLTGRMIGDLVAYAGNPMGAYAEEQILPADKVVPVPSSIDPIVAAS 202
Query: 189 IMLKGMTAQFLLRRCFKVEPGHTVLIQAAAGGVGSLLCQWANALGATVIGTVSTKEKAAQ 248
IMLKGMTAQFLLRRCFKVEPGHT+L+ AAAGGVGSLLCQWANALGATVIGTVST EKAAQ
Sbjct: 203 IMLKGMTAQFLLRRCFKVEPGHTILVHAAAGGVGSLLCQWANALGATVIGTVSTNEKAAQ 262
Query: 249 AKDDGCHH 256
AK+DGCHH
Sbjct: 263 AKEDGCHH 270
|
|
| UNIPROTKB|Q4KKQ5 qor_2 "NADPH:quinone reductase" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48QH7 qor1 "Quinone oxidoreductase" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0232 SPO_0232 "quinone oxidoreductase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P28304 qor [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4KE80 qor_1 "NADPH:quinone reductase" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O53146 qor "NADPH2:quinone reductase" [Mycobacterium tuberculosis H37Rv (taxid:83332)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0BYL8 HNE_2746 "Putative quinone oxidoreductase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2GL79 qor "Quinone oxidoreductase" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|APH_0257 APH_0257 "quinone oxidoreductase" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 256 | |||
| cd05286 | 320 | cd05286, QOR2, Quinone oxidoreductase (QOR) | 1e-104 | |
| COG0604 | 326 | COG0604, Qor, NADPH:quinone reductase and related | 2e-66 | |
| PRK10754 | 327 | PRK10754, PRK10754, quinone oxidoreductase, NADPH- | 2e-62 | |
| cd08268 | 328 | cd08268, MDR2, Medium chain dehydrogenases/reducta | 6e-56 | |
| cd08241 | 323 | cd08241, QOR1, Quinone oxidoreductase (QOR) | 9e-51 | |
| cd08253 | 325 | cd08253, zeta_crystallin, Zeta-crystallin with NAD | 1e-49 | |
| cd05289 | 309 | cd05289, MDR_like_2, alcohol dehydrogenase and qui | 3e-49 | |
| cd08275 | 337 | cd08275, MDR3, Medium chain dehydrogenases/reducta | 9e-47 | |
| cd08273 | 331 | cd08273, MDR8, Medium chain dehydrogenases/reducta | 1e-42 | |
| cd05276 | 323 | cd05276, p53_inducible_oxidoreductase, PIG3 p53-in | 6e-42 | |
| cd08271 | 325 | cd08271, MDR5, Medium chain dehydrogenases/reducta | 4e-41 | |
| cd08250 | 329 | cd08250, Mgc45594_like, Mgc45594 gene product and | 2e-38 | |
| cd08272 | 326 | cd08272, MDR6, Medium chain dehydrogenases/reducta | 9e-38 | |
| cd08267 | 319 | cd08267, MDR1, Medium chain dehydrogenases/reducta | 1e-37 | |
| cd05188 | 271 | cd05188, MDR, Medium chain reductase/dehydrogenase | 4e-37 | |
| TIGR02824 | 325 | TIGR02824, quinone_pig3, putative NAD(P)H quinone | 2e-36 | |
| cd08266 | 342 | cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t | 4e-36 | |
| cd05195 | 293 | cd05195, enoyl_red, enoyl reductase of polyketide | 9e-35 | |
| cd08244 | 324 | cd08244, MDR_enoyl_red, Possible enoyl reductase | 3e-34 | |
| cd08243 | 320 | cd08243, quinone_oxidoreductase_like_1, Quinone ox | 3e-34 | |
| cd05282 | 323 | cd05282, ETR_like, 2-enoyl thioester reductase-lik | 5e-33 | |
| COG1064 | 339 | COG1064, AdhP, Zn-dependent alcohol dehydrogenases | 1e-32 | |
| cd08251 | 303 | cd08251, polyketide_synthase, polyketide synthase | 8e-32 | |
| smart00829 | 287 | smart00829, PKS_ER, Enoylreductase | 2e-31 | |
| cd08252 | 336 | cd08252, AL_MDR, Arginate lyase and other MDR fami | 4e-30 | |
| cd08274 | 350 | cd08274, MDR9, Medium chain dehydrogenases/reducta | 5e-30 | |
| cd08276 | 336 | cd08276, MDR7, Medium chain dehydrogenases/reducta | 5e-29 | |
| cd08297 | 341 | cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA | 4e-28 | |
| cd08259 | 332 | cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD | 2e-27 | |
| cd08245 | 330 | cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD | 9e-26 | |
| PTZ00354 | 334 | PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi | 4e-25 | |
| cd08296 | 333 | cd08296, CAD_like, Cinnamyl alcohol dehydrogenases | 7e-25 | |
| TIGR02817 | 336 | TIGR02817, adh_fam_1, zinc-binding alcohol dehydro | 8e-25 | |
| cd08290 | 341 | cd08290, ETR, 2-enoyl thioester reductase (ETR) | 4e-24 | |
| cd08292 | 324 | cd08292, ETR_like_2, 2-enoyl thioester reductase ( | 6e-24 | |
| cd08254 | 338 | cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e | 1e-23 | |
| cd05288 | 329 | cd05288, PGDH, Prostaglandin dehydrogenases | 8e-23 | |
| cd08249 | 339 | cd08249, enoyl_reductase_like, enoyl_reductase_lik | 2e-22 | |
| cd05284 | 340 | cd05284, arabinose_DH_like, D-arabinose dehydrogen | 2e-22 | |
| cd08264 | 325 | cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t | 5e-22 | |
| COG2130 | 340 | COG2130, COG2130, Putative NADP-dependent oxidored | 6e-22 | |
| cd08291 | 324 | cd08291, ETR_like_1, 2-enoyl thioester reductase ( | 9e-22 | |
| PRK13771 | 334 | PRK13771, PRK13771, putative alcohol dehydrogenase | 4e-21 | |
| pfam08240 | 108 | pfam08240, ADH_N, Alcohol dehydrogenase GroES-like | 3e-19 | |
| cd05283 | 337 | cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA | 4e-19 | |
| cd08298 | 329 | cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA | 2e-18 | |
| cd08263 | 367 | cd08263, Zn_ADH10, Alcohol dehydrogenases of the M | 2e-18 | |
| cd08246 | 393 | cd08246, crotonyl_coA_red, crotonyl-CoA reductase | 2e-17 | |
| cd08236 | 343 | cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog | 9e-17 | |
| cd08279 | 363 | cd08279, Zn_ADH_class_III, Class III alcohol dehyd | 9e-16 | |
| cd08248 | 350 | cd08248, RTN4I1, Human Reticulon 4 Interacting Pro | 1e-15 | |
| cd08234 | 334 | cd08234, threonine_DH_like, L-threonine dehydrogen | 1e-15 | |
| TIGR01751 | 398 | TIGR01751, crot-CoA-red, crotonyl-CoA reductase | 2e-15 | |
| cd08239 | 339 | cd08239, THR_DH_like, L-threonine dehydrogenase (T | 3e-15 | |
| cd08240 | 350 | cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa | 6e-15 | |
| cd08260 | 345 | cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD | 1e-14 | |
| cd08270 | 305 | cd08270, MDR4, Medium chain dehydrogenases/reducta | 2e-14 | |
| COG1062 | 366 | COG1062, AdhC, Zn-dependent alcohol dehydrogenases | 3e-14 | |
| cd08255 | 277 | cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro | 2e-13 | |
| cd08231 | 361 | cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 | 2e-12 | |
| cd08269 | 312 | cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD | 1e-11 | |
| cd08258 | 306 | cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD | 5e-11 | |
| cd08232 | 339 | cd08232, idonate-5-DH, L-idonate 5-dehydrogenase | 8e-11 | |
| cd05280 | 325 | cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ | 9e-11 | |
| cd05285 | 343 | cd05285, sorbitol_DH, Sorbitol dehydrogenase | 3e-10 | |
| cd08281 | 371 | cd08281, liver_ADH_like1, Zinc-dependent alcohol d | 3e-10 | |
| cd08235 | 343 | cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas | 6e-10 | |
| cd08294 | 329 | cd08294, leukotriene_B4_DH_like, 13-PGR is a bifun | 6e-10 | |
| cd08261 | 337 | cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD | 9e-10 | |
| TIGR03989 | 369 | TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa | 2e-09 | |
| TIGR02823 | 323 | TIGR02823, oxido_YhdH, putative quinone oxidoreduc | 2e-09 | |
| PRK09422 | 338 | PRK09422, PRK09422, ethanol-active dehydrogenase/a | 2e-09 | |
| cd08288 | 324 | cd08288, MDR_yhdh, Yhdh putative quinone oxidoredu | 8e-09 | |
| cd05279 | 365 | cd05279, Zn_ADH1, Liver alcohol dehydrogenase and | 1e-08 | |
| TIGR03451 | 358 | TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi | 1e-08 | |
| cd08278 | 365 | cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro | 2e-08 | |
| COG1063 | 350 | COG1063, Tdh, Threonine dehydrogenase and related | 3e-08 | |
| cd08233 | 351 | cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio | 5e-08 | |
| cd08300 | 368 | cd08300, alcohol_DH_class_III, class III alcohol d | 5e-08 | |
| cd08277 | 365 | cd08277, liver_alcohol_DH_like, Liver alcohol dehy | 7e-08 | |
| cd05281 | 341 | cd05281, TDH, Threonine dehydrogenase | 1e-07 | |
| TIGR02822 | 329 | TIGR02822, adh_fam_2, zinc-binding alcohol dehydro | 2e-07 | |
| PRK05396 | 341 | PRK05396, tdh, L-threonine 3-dehydrogenase; Valida | 5e-07 | |
| PLN02514 | 357 | PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase | 6e-07 | |
| TIGR03201 | 349 | TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1 | 8e-07 | |
| TIGR02825 | 325 | TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehy | 2e-06 | |
| cd08289 | 326 | cd08289, MDR_yhfp_like, Yhfp putative quinone oxid | 3e-06 | |
| cd08262 | 341 | cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD | 3e-06 | |
| cd08295 | 338 | cd08295, double_bond_reductase_like, Arabidopsis a | 3e-06 | |
| TIGR00692 | 340 | TIGR00692, tdh, L-threonine 3-dehydrogenase | 3e-06 | |
| TIGR02818 | 368 | TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat | 3e-05 | |
| pfam00107 | 131 | pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase | 3e-05 | |
| cd08284 | 344 | cd08284, FDH_like_2, Glutathione-dependent formald | 2e-04 | |
| cd08256 | 350 | cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD | 2e-04 | |
| cd08301 | 369 | cd08301, alcohol_DH_plants, Plant alcohol dehydrog | 6e-04 | |
| cd08242 | 319 | cd08242, MDR_like, Medium chain dehydrogenases/red | 6e-04 | |
| TIGR01202 | 308 | TIGR01202, bchC, 2-desacetyl-2-hydroxyethyl bacter | 0.001 | |
| cd08293 | 345 | cd08293, PTGR2, Prostaglandin reductase | 0.002 | |
| cd08285 | 351 | cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd | 0.002 | |
| cd08247 | 352 | cd08247, AST1_like, AST1 is a cytoplasmic protein | 0.002 | |
| TIGR03366 | 280 | TIGR03366, HpnZ_proposed, putative phosphonate cat | 0.003 | |
| PRK10083 | 339 | PRK10083, PRK10083, putative oxidoreductase; Provi | 0.003 | |
| PLN03154 | 348 | PLN03154, PLN03154, putative allyl alcohol dehydro | 0.004 |
| >gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
Score = 304 bits (782), Expect = e-104
Identities = 104/186 (55%), Positives = 139/186 (74%), Gaps = 2/186 (1%)
Query: 71 KAIRVYEHGDPEVLKWEDVEIGEPGEGEIRVRNKAIGLNFIDVYYRKGVYKPAKMPFTPG 130
KA+R+++ G PEVL++EDV + EPG GE+ VRN AIG+NFID Y+R G+Y P +PF G
Sbjct: 1 KAVRIHKTGGPEVLEYEDVPVPEPGPGEVLVRNTAIGVNFIDTYFRSGLY-PLPLPFVLG 59
Query: 131 MEAVGEVVAVGPGLTGRTVGDIIAYAGGAMGSYAEEQILPANKVVPVPSSIDPVIAASIM 190
+E G V AVGPG+TG VGD +AYAG G+YAE +++PA+++V +P I AA+++
Sbjct: 60 VEGAGVVEAVGPGVTGFKVGDRVAYAG-PPGAYAEYRVVPASRLVKLPDGISDETAAALL 118
Query: 191 LKGMTAQFLLRRCFKVEPGHTVLIQAAAGGVGSLLCQWANALGATVIGTVSTKEKAAQAK 250
L+G+TA +LLR + V+PG TVL+ AAAGGVG LL QWA ALGATVIGTVS++EKA A+
Sbjct: 119 LQGLTAHYLLRETYPVKPGDTVLVHAAAGGVGLLLTQWAKALGATVIGTVSSEEKAELAR 178
Query: 251 DDGCHH 256
G H
Sbjct: 179 AAGADH 184
|
Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone and 1,4-naphthoquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 320 |
| >gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase | Back alignment and domain information |
|---|
| >gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like | Back alignment and domain information |
|---|
| >gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 | Back alignment and domain information |
|---|
| >gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family | Back alignment and domain information |
|---|
| >gnl|CDD|234026 TIGR02823, oxido_YhdH, putative quinone oxidoreductase, YhdH/YhfP family | Back alignment and domain information |
|---|
| >gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176248 cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|131872 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176255 cd08295, double_bond_reductase_like, Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|130269 TIGR01202, bchC, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176253 cd08293, PTGR2, Prostaglandin reductase | Back alignment and domain information |
|---|
| >gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast | Back alignment and domain information |
|---|
| >gnl|CDD|132409 TIGR03366, HpnZ_proposed, putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215606 PLN03154, PLN03154, putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 256 | |||
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 100.0 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 100.0 | |
| KOG1197 | 336 | consensus Predicted quinone oxidoreductase [Energy | 100.0 | |
| COG1062 | 366 | AdhC Zn-dependent alcohol dehydrogenases, class II | 100.0 | |
| KOG0023 | 360 | consensus Alcohol dehydrogenase, class V [Secondar | 100.0 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 100.0 | |
| KOG0022 | 375 | consensus Alcohol dehydrogenase, class III [Second | 100.0 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 100.0 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 100.0 | |
| TIGR02818 | 368 | adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr | 100.0 | |
| cd08301 | 369 | alcohol_DH_plants Plant alcohol dehydrogenase. NAD | 100.0 | |
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 100.0 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 100.0 | |
| cd08300 | 368 | alcohol_DH_class_III class III alcohol dehydrogena | 100.0 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 100.0 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 100.0 | |
| cd08277 | 365 | liver_alcohol_DH_like Liver alcohol dehydrogenase. | 100.0 | |
| PLN02827 | 378 | Alcohol dehydrogenase-like | 100.0 | |
| KOG0025 | 354 | consensus Zn2+-binding dehydrogenase (nuclear rece | 100.0 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 100.0 | |
| cd08291 | 324 | ETR_like_1 2-enoyl thioester reductase (ETR) like | 100.0 | |
| TIGR02817 | 336 | adh_fam_1 zinc-binding alcohol dehydrogenase famil | 100.0 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 100.0 | |
| TIGR02819 | 393 | fdhA_non_GSH formaldehyde dehydrogenase, glutathio | 100.0 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 100.0 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 100.0 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 100.0 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 100.0 | |
| PRK10754 | 327 | quinone oxidoreductase, NADPH-dependent; Provision | 100.0 | |
| cd08299 | 373 | alcohol_DH_class_I_II_IV class I, II, IV alcohol d | 99.98 | |
| cd08231 | 361 | MDR_TM0436_like Hypothetical enzyme TM0436 resembl | 99.97 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 99.97 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 99.97 | |
| cd08296 | 333 | CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci | 99.97 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 99.97 | |
| cd08290 | 341 | ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi | 99.97 | |
| cd08278 | 365 | benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be | 99.97 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 99.97 | |
| cd08238 | 410 | sorbose_phosphate_red L-sorbose-1-phosphate reduct | 99.97 | |
| cd08233 | 351 | butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog | 99.97 | |
| cd08246 | 393 | crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- | 99.97 | |
| PTZ00354 | 334 | alcohol dehydrogenase; Provisional | 99.97 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 99.97 | |
| cd05280 | 325 | MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone | 99.97 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 99.97 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 99.97 | |
| PRK10083 | 339 | putative oxidoreductase; Provisional | 99.97 | |
| cd08243 | 320 | quinone_oxidoreductase_like_1 Quinone oxidoreducta | 99.97 | |
| cd08285 | 351 | NADP_ADH NADP(H)-dependent alcohol dehydrogenases. | 99.97 | |
| cd08274 | 350 | MDR9 Medium chain dehydrogenases/reductase (MDR)/z | 99.97 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 99.97 | |
| cd05284 | 340 | arabinose_DH_like D-arabinose dehydrogenase. This | 99.97 | |
| cd08250 | 329 | Mgc45594_like Mgc45594 gene product and other MDR | 99.97 | |
| cd08270 | 305 | MDR4 Medium chain dehydrogenases/reductase (MDR)/z | 99.97 | |
| cd08244 | 324 | MDR_enoyl_red Possible enoyl reductase. Member ide | 99.97 | |
| PRK09422 | 338 | ethanol-active dehydrogenase/acetaldehyde-active r | 99.97 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 99.97 | |
| cd05279 | 365 | Zn_ADH1 Liver alcohol dehydrogenase and related zi | 99.97 | |
| cd08259 | 332 | Zn_ADH5 Alcohol dehydrogenases of the MDR family. | 99.97 | |
| cd08288 | 324 | MDR_yhdh Yhdh putative quinone oxidoreductases. Yh | 99.97 | |
| cd08252 | 336 | AL_MDR Arginate lyase and other MDR family members | 99.97 | |
| TIGR01751 | 398 | crot-CoA-red crotonyl-CoA reductase. The enzyme mo | 99.97 | |
| cd08298 | 329 | CAD2 Cinnamyl alcohol dehydrogenases (CAD). These | 99.97 | |
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 99.97 | |
| cd08297 | 341 | CAD3 Cinnamyl alcohol dehydrogenases (CAD). These | 99.97 | |
| PRK13771 | 334 | putative alcohol dehydrogenase; Provisional | 99.97 | |
| cd08260 | 345 | Zn_ADH6 Alcohol dehydrogenases of the MDR family. | 99.97 | |
| cd08283 | 386 | FDH_like_1 Glutathione-dependent formaldehyde dehy | 99.97 | |
| TIGR02823 | 323 | oxido_YhdH putative quinone oxidoreductase, YhdH/Y | 99.97 | |
| cd05278 | 347 | FDH_like Formaldehyde dehydrogenases. Formaldehyde | 99.97 | |
| cd08249 | 339 | enoyl_reductase_like enoyl_reductase_like. Member | 99.97 | |
| cd08279 | 363 | Zn_ADH_class_III Class III alcohol dehydrogenase. | 99.97 | |
| cd08273 | 331 | MDR8 Medium chain dehydrogenases/reductase (MDR)/z | 99.96 | |
| cd08286 | 345 | FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik | 99.96 | |
| cd08263 | 367 | Zn_ADH10 Alcohol dehydrogenases of the MDR family. | 99.96 | |
| cd08240 | 350 | 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy | 99.96 | |
| cd08256 | 350 | Zn_ADH2 Alcohol dehydrogenases of the MDR family. | 99.96 | |
| cd08264 | 325 | Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam | 99.96 | |
| cd08282 | 375 | PFDH_like Pseudomonas putida aldehyde-dismutating | 99.96 | |
| cd08248 | 350 | RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu | 99.96 | |
| cd05283 | 337 | CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam | 99.96 | |
| cd08261 | 337 | Zn_ADH7 Alcohol dehydrogenases of the MDR family. | 99.96 | |
| cd08262 | 341 | Zn_ADH8 Alcohol dehydrogenases of the MDR family. | 99.96 | |
| cd05282 | 323 | ETR_like 2-enoyl thioester reductase-like. 2-enoyl | 99.96 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 99.96 | |
| cd08235 | 343 | iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ | 99.96 | |
| cd05276 | 323 | p53_inducible_oxidoreductase PIG3 p53-inducible qu | 99.96 | |
| cd08276 | 336 | MDR7 Medium chain dehydrogenases/reductase (MDR)/z | 99.96 | |
| cd08284 | 344 | FDH_like_2 Glutathione-dependent formaldehyde dehy | 99.96 | |
| cd08258 | 306 | Zn_ADH4 Alcohol dehydrogenases of the MDR family. | 99.96 | |
| cd08254 | 338 | hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo | 99.96 | |
| cd08272 | 326 | MDR6 Medium chain dehydrogenases/reductase (MDR)/z | 99.96 | |
| cd08242 | 319 | MDR_like Medium chain dehydrogenases/reductase (MD | 99.96 | |
| cd05286 | 320 | QOR2 Quinone oxidoreductase (QOR). Quinone oxidore | 99.96 | |
| cd08236 | 343 | sugar_DH NAD(P)-dependent sugar dehydrogenases. Th | 99.96 | |
| cd08266 | 342 | Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam | 99.96 | |
| cd08234 | 334 | threonine_DH_like L-threonine dehydrogenase. L-thr | 99.96 | |
| cd08271 | 325 | MDR5 Medium chain dehydrogenases/reductase (MDR)/z | 99.95 | |
| cd08245 | 330 | CAD Cinnamyl alcohol dehydrogenases (CAD) and rela | 99.95 | |
| cd08247 | 352 | AST1_like AST1 is a cytoplasmic protein associated | 99.95 | |
| cd08268 | 328 | MDR2 Medium chain dehydrogenases/reductase (MDR)/z | 99.95 | |
| PRK05396 | 341 | tdh L-threonine 3-dehydrogenase; Validated | 99.95 | |
| cd08287 | 345 | FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik | 99.95 | |
| cd05289 | 309 | MDR_like_2 alcohol dehydrogenase and quinone reduc | 99.95 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 99.95 | |
| cd08267 | 319 | MDR1 Medium chain dehydrogenases/reductase (MDR)/z | 99.95 | |
| TIGR02824 | 325 | quinone_pig3 putative NAD(P)H quinone oxidoreducta | 99.95 | |
| PLN02702 | 364 | L-idonate 5-dehydrogenase | 99.95 | |
| cd05285 | 343 | sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a | 99.95 | |
| cd08265 | 384 | Zn_ADH3 Alcohol dehydrogenases of the MDR family. | 99.95 | |
| cd08232 | 339 | idonate-5-DH L-idonate 5-dehydrogenase. L-idonate | 99.95 | |
| cd08269 | 312 | Zn_ADH9 Alcohol dehydrogenases of the MDR family. | 99.94 | |
| cd05288 | 329 | PGDH Prostaglandin dehydrogenases. Prostaglandins | 99.94 | |
| cd05281 | 341 | TDH Threonine dehydrogenase. L-threonine dehydroge | 99.94 | |
| cd08251 | 303 | polyketide_synthase polyketide synthase. Polyketid | 99.94 | |
| cd08241 | 323 | QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t | 99.94 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 99.94 | |
| TIGR00692 | 340 | tdh L-threonine 3-dehydrogenase. E. coli His-90 mo | 99.94 | |
| cd08275 | 337 | MDR3 Medium chain dehydrogenases/reductase (MDR)/z | 99.93 | |
| cd05195 | 293 | enoyl_red enoyl reductase of polyketide synthase. | 99.93 | |
| COG2130 | 340 | Putative NADP-dependent oxidoreductases [General f | 99.92 | |
| smart00829 | 288 | PKS_ER Enoylreductase. Enoylreductase in Polyketid | 99.92 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 99.91 | |
| cd08255 | 277 | 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ | 99.84 | |
| KOG1196 | 343 | consensus Predicted NAD-dependent oxidoreductase [ | 99.8 | |
| PF08240 | 109 | ADH_N: Alcohol dehydrogenase GroES-like domain; In | 99.78 | |
| KOG1202 | 2376 | consensus Animal-type fatty acid synthase and rela | 99.77 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 98.37 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 97.76 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 97.47 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 97.19 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 97.15 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 97.06 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 96.98 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 96.72 | |
| PLN02494 | 477 | adenosylhomocysteinase | 96.59 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 96.45 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 96.39 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 96.26 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.15 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 96.15 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 96.03 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 96.0 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 95.96 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 95.92 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 95.9 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 95.9 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 95.9 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 95.89 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 95.81 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 95.79 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 95.75 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 95.73 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 95.67 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 95.66 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 95.52 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 95.5 | |
| PF11017 | 314 | DUF2855: Protein of unknown function (DUF2855); In | 95.19 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 95.19 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 95.18 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 95.14 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 95.13 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 95.11 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 95.03 | |
| KOG1252 | 362 | consensus Cystathionine beta-synthase and related | 94.9 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 94.63 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 94.62 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 94.57 | |
| KOG1210 | 331 | consensus Predicted 3-ketosphinganine reductase [S | 94.48 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 94.4 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 94.39 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 94.38 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.38 | |
| COG0031 | 300 | CysK Cysteine synthase [Amino acid transport and m | 94.37 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 94.35 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 94.33 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 94.27 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 94.23 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 94.02 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 94.0 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 93.86 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 93.86 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 93.82 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 93.78 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 93.54 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 93.5 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 93.38 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 93.32 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 93.27 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 93.27 | |
| PLN03013 | 429 | cysteine synthase | 93.25 | |
| PLN02565 | 322 | cysteine synthase | 93.15 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 93.1 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 93.09 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 93.01 | |
| KOG1014 | 312 | consensus 17 beta-hydroxysteroid dehydrogenase typ | 92.96 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 92.94 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 92.92 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.62 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 92.62 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.52 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 92.38 | |
| PF13823 | 23 | ADH_N_assoc: Alcohol dehydrogenase GroES-associate | 92.31 | |
| PLN02556 | 368 | cysteine synthase/L-3-cyanoalanine synthase | 92.08 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 92.07 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 92.06 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 92.03 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 91.88 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 91.86 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 91.8 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 91.77 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 91.56 | |
| TIGR01138 | 290 | cysM cysteine synthase B. Alternate name: O-acetyl | 91.46 | |
| PRK11761 | 296 | cysM cysteine synthase B; Provisional | 91.36 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 91.3 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 91.25 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 91.23 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 91.22 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 91.07 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 91.04 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 91.04 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 90.8 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 90.74 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.6 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 90.47 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 90.24 | |
| PRK10717 | 330 | cysteine synthase A; Provisional | 90.17 | |
| KOG1200 | 256 | consensus Mitochondrial/plastidial beta-ketoacyl-A | 90.15 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 90.13 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 90.07 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 90.06 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 89.94 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 89.93 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 89.91 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 89.88 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 89.82 | |
| TIGR01139 | 298 | cysK cysteine synthase A. This model distinguishes | 89.76 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 89.65 | |
| PLN00011 | 323 | cysteine synthase | 89.63 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 89.61 | |
| TIGR01136 | 299 | cysKM cysteine synthases. This model discriminates | 89.61 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 89.58 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 89.57 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 89.38 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 89.32 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 89.25 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 89.13 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 89.12 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 88.97 | |
| PF12242 | 78 | Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 | 88.89 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 88.86 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 88.8 | |
| cd01562 | 304 | Thr-dehyd Threonine dehydratase: The first step in | 88.78 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 88.57 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 88.51 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 88.39 | |
| PLN02928 | 347 | oxidoreductase family protein | 88.36 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 88.13 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 88.05 | |
| KOG1610 | 322 | consensus Corticosteroid 11-beta-dehydrogenase and | 88.04 | |
| cd06447 | 404 | D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph | 87.94 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 87.84 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.66 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 87.61 | |
| PLN02970 | 328 | serine racemase | 87.42 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 87.4 | |
| PRK06110 | 322 | hypothetical protein; Provisional | 87.33 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 87.28 | |
| PLN02477 | 410 | glutamate dehydrogenase | 87.25 | |
| PLN02356 | 423 | phosphateglycerate kinase | 87.24 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 87.14 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 87.13 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 87.1 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 86.86 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 86.85 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 86.81 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 86.8 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 86.8 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 86.8 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 86.79 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 86.77 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 86.77 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 86.68 | |
| cd01561 | 291 | CBS_like CBS_like: This subgroup includes Cystathi | 86.59 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 86.56 | |
| KOG1203 | 411 | consensus Predicted dehydrogenase [Carbohydrate tr | 86.51 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 86.48 | |
| PRK07048 | 321 | serine/threonine dehydratase; Validated | 86.26 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.23 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 86.18 | |
| cd00640 | 244 | Trp-synth-beta_II Tryptophan synthase beta superfa | 85.95 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 85.86 | |
| PRK06381 | 319 | threonine synthase; Validated | 85.85 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 85.85 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 85.75 | |
| cd06448 | 316 | L-Ser-dehyd Serine dehydratase is a pyridoxal phos | 85.73 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 85.53 | |
| TIGR02035 | 431 | D_Ser_am_lyase D-serine ammonia-lyase. This family | 85.52 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 85.5 | |
| PLN02256 | 304 | arogenate dehydrogenase | 85.26 | |
| PF02670 | 129 | DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re | 85.1 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 85.05 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 84.79 | |
| PRK06608 | 338 | threonine dehydratase; Provisional | 84.66 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 84.56 | |
| PF10686 | 71 | DUF2493: Protein of unknown function (DUF2493); In | 84.36 | |
| PTZ00414 | 100 | 10 kDa heat shock protein; Provisional | 84.2 | |
| PRK08246 | 310 | threonine dehydratase; Provisional | 84.16 | |
| PRK08638 | 333 | threonine dehydratase; Validated | 84.15 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.14 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 84.07 | |
| cd01563 | 324 | Thr-synth_1 Threonine synthase is a pyridoxal phos | 84.02 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 83.74 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 83.59 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 83.58 | |
| PF13580 | 138 | SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_ | 83.18 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 83.13 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 83.04 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 82.94 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 82.91 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 82.89 | |
| PRK00364 | 95 | groES co-chaperonin GroES; Reviewed | 82.77 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 82.75 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 82.71 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 82.53 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 82.47 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 82.45 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 82.41 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 82.4 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 82.2 | |
| PF00208 | 244 | ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val | 82.17 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 82.05 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 82.05 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 81.86 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 81.44 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 81.24 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 81.06 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 81.05 | |
| PRK06721 | 352 | threonine synthase; Reviewed | 80.8 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 80.71 | |
| PRK02991 | 441 | D-serine dehydratase; Provisional | 80.67 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 80.6 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 80.46 | |
| TIGR02991 | 317 | ectoine_eutB ectoine utilization protein EutB. Mem | 80.19 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 80.14 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 80.09 |
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.2e-44 Score=310.66 Aligned_cols=185 Identities=38% Similarity=0.597 Sum_probs=175.8
Q ss_pred cceEEEEEcccCCCCceEEEEeeCCCCCCCeEEEEEeEEeeChhhhHhHhCCCCCCCCCCCCCcccEEEEEEeCCCCCcc
Q 036416 68 NMVKAIRVYEHGDPEVLKWEDVEIGEPGEGEIRVRNKAIGLNFIDVYYRKGVYKPAKMPFTPGMEAVGEVVAVGPGLTGR 147 (256)
Q Consensus 68 ~~~~a~~~~~~~~~~~l~~~~~~~p~~~~~eVlVkv~~~~i~~~D~~~~~g~~~~~~~p~~lG~e~~G~V~~vG~~v~~~ 147 (256)
++|||+++.+++.| +++++++.|+|+++||+|+|+|+|+|++|+|.+.|.++...+|+++|||.+|+|+++|++|++|
T Consensus 2 ~~mkA~~~~~~~~p--l~i~e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~~~~~P~ipGHEivG~V~~vG~~V~~~ 79 (339)
T COG1064 2 MTMKAAVLKKFGQP--LEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWPVPKLPLIPGHEIVGTVVEVGEGVTGL 79 (339)
T ss_pred cceEEEEEccCCCC--ceEEeccCCCCCCCeEEEEEEEEeecchhhhhhcCCCCCCCCCccCCcceEEEEEEecCCCccC
Confidence 57999999999888 8899999999999999999999999999999999999998899999999999999999999999
Q ss_pred CCCCEEEE-eC--------------------------CCCcceeeEEEecCCCeEECCCCCCHHHHhhhchhHHHHHHHH
Q 036416 148 TVGDIIAY-AG--------------------------GAMGSYAEEQILPANKVVPVPSSIDPVIAASIMLKGMTAQFLL 200 (256)
Q Consensus 148 ~~Gd~V~~-~~--------------------------~~~G~~a~~~~v~~~~~~~ip~~~~~~~aa~l~~~~~ta~~~l 200 (256)
++||||.+ +. ..+|+|+||+++|+.+++++|+++++++||.+.+++.|.|.+|
T Consensus 80 k~GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~~gy~~~GGyaeyv~v~~~~~~~iP~~~d~~~aApllCaGiT~y~al 159 (339)
T COG1064 80 KVGDRVGVGWLVISCGECEYCRSGNENLCPNQKITGYTTDGGYAEYVVVPARYVVKIPEGLDLAEAAPLLCAGITTYRAL 159 (339)
T ss_pred CCCCEEEecCccCCCCCCccccCcccccCCCccccceeecCcceeEEEEchHHeEECCCCCChhhhhhhhcCeeeEeeeh
Confidence 99999987 21 1269999999999999999999999999999999999999999
Q ss_pred HHHcCCCCCCEEEEecCCChHHHHHHHHHHHcCCeEEEEeCChhhHHHHHhCCCCC
Q 036416 201 RRCFKVEPGHTVLIQAAAGGVGSLLCQWANALGATVIGTVSTKEKAAQAKDDGCHH 256 (256)
Q Consensus 201 ~~~~~~~~g~~VlI~ga~g~vG~~ai~la~~~ga~Vi~~~~~~~~~~~~~~~Ga~~ 256 (256)
+. .+++||++|+|.| .|++|.+++|+|+.+|++|++++++++|++++++||||+
T Consensus 160 k~-~~~~pG~~V~I~G-~GGlGh~avQ~Aka~ga~Via~~~~~~K~e~a~~lGAd~ 213 (339)
T COG1064 160 KK-ANVKPGKWVAVVG-AGGLGHMAVQYAKAMGAEVIAITRSEEKLELAKKLGADH 213 (339)
T ss_pred hh-cCCCCCCEEEEEC-CcHHHHHHHHHHHHcCCeEEEEeCChHHHHHHHHhCCcE
Confidence 77 7999999999999 589999999999999999999999999999999999985
|
|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >cd08300 alcohol_DH_class_III class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02827 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 | Back alignment and domain information |
|---|
| >TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional | Back alignment and domain information |
|---|
| >cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >cd08290 ETR 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase | Back alignment and domain information |
|---|
| >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >cd08246 crotonyl_coA_red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >PTZ00354 alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >PRK10083 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >cd05284 arabinose_DH_like D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08244 MDR_enoyl_red Possible enoyl reductase | Back alignment and domain information |
|---|
| >PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08252 AL_MDR Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >TIGR01751 crot-CoA-red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >PRK13771 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family | Back alignment and domain information |
|---|
| >cd05278 FDH_like Formaldehyde dehydrogenases | Back alignment and domain information |
|---|
| >cd08249 enoyl_reductase_like enoyl_reductase_like | Back alignment and domain information |
|---|
| >cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase | Back alignment and domain information |
|---|
| >cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 | Back alignment and domain information |
|---|
| >cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05282 ETR_like 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05286 QOR2 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08234 threonine_DH_like L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast | Back alignment and domain information |
|---|
| >cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PRK05396 tdh L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >PLN02702 L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd05285 sorbitol_DH Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08232 idonate-5-DH L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05288 PGDH Prostaglandin dehydrogenases | Back alignment and domain information |
|---|
| >cd05281 TDH Threonine dehydrogenase | Back alignment and domain information |
|---|
| >cd08251 polyketide_synthase polyketide synthase | Back alignment and domain information |
|---|
| >cd08241 QOR1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR00692 tdh L-threonine 3-dehydrogenase | Back alignment and domain information |
|---|
| >cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05195 enoyl_red enoyl reductase of polyketide synthase | Back alignment and domain information |
|---|
| >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >smart00829 PKS_ER Enoylreductase | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
| >KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 | Back alignment and domain information |
|---|
| >KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03013 cysteine synthase | Back alignment and domain information |
|---|
| >PLN02565 cysteine synthase | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B | Back alignment and domain information |
|---|
| >PLN02556 cysteine synthase/L-3-cyanoalanine synthase | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >TIGR01138 cysM cysteine synthase B | Back alignment and domain information |
|---|
| >PRK11761 cysM cysteine synthase B; Provisional | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10717 cysteine synthase A; Provisional | Back alignment and domain information |
|---|
| >KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >TIGR01139 cysK cysteine synthase A | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >PLN00011 cysteine synthase | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >TIGR01136 cysKM cysteine synthases | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] | Back alignment and domain information |
|---|
| >cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02970 serine racemase | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06110 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02356 phosphateglycerate kinase | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07048 serine/threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06381 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06608 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PF10686 DUF2493: Protein of unknown function (DUF2493); InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61 | Back alignment and domain information |
|---|
| >PTZ00414 10 kDa heat shock protein; Provisional | Back alignment and domain information |
|---|
| >PRK08246 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08638 threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13580 SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_A 3BJZ_D 2XBL_B 2X3Y_F 2YVA_B 3CVJ_D 3TRJ_D | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00364 groES co-chaperonin GroES; Reviewed | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK06721 threonine synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK02991 D-serine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >TIGR02991 ectoine_eutB ectoine utilization protein EutB | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 256 | ||||
| 3jyl_A | 325 | Crystal Structures Of Pseudomonas Syringae Pv. Toma | 4e-40 | ||
| 1wly_A | 333 | Crystal Structure Of 2-haloacrylate Reductase Lengt | 1e-37 | ||
| 1qor_A | 327 | Crystal Structure Of Escherichia Coli Quinone Oxido | 1e-32 | ||
| 3qwa_A | 334 | Crystal Structure Of Saccharomyces Cerevisiae Zeta- | 2e-16 | ||
| 2wek_A | 341 | Crystal Structure Of The Human Mgc45594 Gene Produc | 5e-15 | ||
| 2c0c_A | 362 | Structure Of The Mgc45594 Gene Product Length = 362 | 5e-15 | ||
| 2x7h_A | 370 | Crystal Structure Of The Human Mgc45594 Gene Produc | 5e-15 | ||
| 1yb5_A | 351 | Crystal Structure Of Human Zeta-crystallin With Bou | 3e-14 | ||
| 2eih_A | 343 | Crystal Structure Of Nad-Dependent Alcohol Dehydrog | 3e-14 | ||
| 4a27_A | 349 | Crystal Structure Of Human Synaptic Vesicle Membran | 6e-11 | ||
| 3fbg_A | 346 | Crystal Structure Of A Putative Arginate Lyase From | 1e-08 | ||
| 2eer_A | 347 | Structural Study Of Project Id St2577 From Sulfolob | 8e-08 | ||
| 4dup_A | 353 | Crystal Structure Of A Quinone Oxidoreductase From | 9e-08 | ||
| 1zsy_A | 357 | The Structure Of Human Mitochondrial 2-Enoyl Thioes | 5e-07 | ||
| 2vcy_A | 344 | Crystal Structure Of 2-Enoyl Thioester Reductase Of | 6e-07 | ||
| 3tqh_A | 321 | Structure Of The Quinone Oxidoreductase From Coxiel | 1e-06 | ||
| 1v3t_A | 333 | Crystal Structure Of Leukotriene B4 12- Hydroxydehy | 2e-05 | ||
| 3slk_A | 795 | Structure Of Ketoreductase And Enoylreductase Didom | 2e-05 | ||
| 2cf2_D | 295 | Architecture Of Mammalian Fatty Acid Synthase Lengt | 3e-05 | ||
| 1zsv_A | 349 | Crystal Structure Of Human Nadp-Dependent Leukotrie | 3e-05 | ||
| 1iyz_A | 302 | Crystal Structures Of The Quinone Oxidoreductase Fr | 3e-05 | ||
| 2y05_A | 328 | Crystal Structure Of Human Leukotriene B4 12-Hydrox | 4e-05 | ||
| 4hfj_A | 351 | X-ray Crystal Structure Of A Double Bond Reductase | 1e-04 | ||
| 2j8z_A | 354 | Crystal Structure Of Human P53 Inducible Oxidoreduc | 2e-04 | ||
| 2oby_A | 338 | Crystal Structure Of Human P53 Inducible Oxidoreduc | 2e-04 | ||
| 3uog_A | 363 | Crystal Structure Of Putative Alcohol Dehydrogenase | 5e-04 | ||
| 1iz0_A | 302 | Crystal Structures Of The Quinone Oxidoreductase Fr | 7e-04 |
| >pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 | Back alignment and structure |
|
| >pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 | Back alignment and structure |
| >pdb|1QOR|A Chain A, Crystal Structure Of Escherichia Coli Quinone Oxidoreductase Complexed With Nadph Length = 327 | Back alignment and structure |
| >pdb|3QWA|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Zeta-Crystallin-Like Quinone Oxidoreductase Zta1 Length = 334 | Back alignment and structure |
| >pdb|2WEK|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Diclofenac Length = 341 | Back alignment and structure |
| >pdb|2C0C|A Chain A, Structure Of The Mgc45594 Gene Product Length = 362 | Back alignment and structure |
| >pdb|2X7H|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Fenoprofen Length = 370 | Back alignment and structure |
| >pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 | Back alignment and structure |
| >pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 | Back alignment and structure |
| >pdb|4A27|A Chain A, Crystal Structure Of Human Synaptic Vesicle Membrane Protein Vat-1 Homolog-Like Protein Length = 349 | Back alignment and structure |
| >pdb|3FBG|A Chain A, Crystal Structure Of A Putative Arginate Lyase From Staphylococcus Haemolyticus Length = 346 | Back alignment and structure |
| >pdb|2EER|A Chain A, Structural Study Of Project Id St2577 From Sulfolobus Tokodaii Strain7 Length = 347 | Back alignment and structure |
| >pdb|4DUP|A Chain A, Crystal Structure Of A Quinone Oxidoreductase From Rhizobium Etli Cfn 42 Length = 353 | Back alignment and structure |
| >pdb|1ZSY|A Chain A, The Structure Of Human Mitochondrial 2-Enoyl Thioester Reductase (Cgi- 63) Length = 357 | Back alignment and structure |
| >pdb|2VCY|A Chain A, Crystal Structure Of 2-Enoyl Thioester Reductase Of Human Fas Ii Length = 344 | Back alignment and structure |
| >pdb|3TQH|A Chain A, Structure Of The Quinone Oxidoreductase From Coxiella Burnetii Length = 321 | Back alignment and structure |
| >pdb|1V3T|A Chain A, Crystal Structure Of Leukotriene B4 12- Hydroxydehydrogenase15-Oxo-Prostaglandin 13-Reductase Length = 333 | Back alignment and structure |
| >pdb|3SLK|A Chain A, Structure Of Ketoreductase And Enoylreductase Didomain From Modular Polyketide Synthase Length = 795 | Back alignment and structure |
| >pdb|2CF2|D Chain D, Architecture Of Mammalian Fatty Acid Synthase Length = 295 | Back alignment and structure |
| >pdb|1ZSV|A Chain A, Crystal Structure Of Human Nadp-Dependent Leukotriene B4 12- Hydroxydehydrogenase Length = 349 | Back alignment and structure |
| >pdb|1IYZ|A Chain A, Crystal Structures Of The Quinone Oxidoreductase From Thermus Thermophilus Hb8 And Its Complex With Nadph Length = 302 | Back alignment and structure |
| >pdb|2Y05|A Chain A, Crystal Structure Of Human Leukotriene B4 12-Hydroxydehydrogenase In Complex With Nadp And Raloxifene Length = 328 | Back alignment and structure |
| >pdb|4HFJ|A Chain A, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum Length = 351 | Back alignment and structure |
| >pdb|2J8Z|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase ( Tp53i3,Pig3) Length = 354 | Back alignment and structure |
| >pdb|2OBY|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase (Tp53i3,Pig3) Length = 338 | Back alignment and structure |
| >pdb|3UOG|A Chain A, Crystal Structure Of Putative Alcohol Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 363 | Back alignment and structure |
| >pdb|1IZ0|A Chain A, Crystal Structures Of The Quinone Oxidoreductase From Thermus Thermophilus Hb8 And Its Complex With Nadph Length = 302 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 256 | |||
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 1e-108 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 1e-107 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 1e-104 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 1e-100 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 9e-90 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 2e-87 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 4e-72 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 1e-69 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 7e-69 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 3e-68 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 3e-66 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 7e-62 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 2e-55 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 1e-54 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 3e-54 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 1e-53 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 1e-52 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 5e-51 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 6e-51 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 3e-50 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 1e-48 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 2e-48 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 1e-47 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 4e-46 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 1e-44 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 8e-42 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 3e-39 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 1e-35 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 5e-34 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 4e-33 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 1e-31 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 8e-31 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 1e-29 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 5e-29 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 2e-27 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 1e-23 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 8e-23 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 2e-22 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 2e-19 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 2e-17 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 2e-17 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 5e-17 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 7e-17 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 1e-16 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 1e-16 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 2e-16 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 3e-16 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 5e-16 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 8e-16 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 2e-15 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 4e-15 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 5e-15 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 7e-15 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 9e-15 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 6e-14 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 6e-14 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 1e-13 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 2e-13 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 4e-13 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 5e-13 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 6e-13 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 3e-12 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 3e-12 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 2e-11 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 2e-11 |
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 | Back alignment and structure |
|---|
Score = 314 bits (808), Expect = e-108
Identities = 95/188 (50%), Positives = 121/188 (64%)
Query: 69 MVKAIRVYEHGDPEVLKWEDVEIGEPGEGEIRVRNKAIGLNFIDVYYRKGVYKPAKMPFT 128
M K I+ G PEVL++ D E PG + VRNKAIGLNFID YYR G+Y +P
Sbjct: 1 MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSG 60
Query: 129 PGMEAVGEVVAVGPGLTGRTVGDIIAYAGGAMGSYAEEQILPANKVVPVPSSIDPVIAAS 188
G E G V AVG +T VGD +AY G +G+Y+E +LP +V + S+ AA+
Sbjct: 61 LGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAA 120
Query: 189 IMLKGMTAQFLLRRCFKVEPGHTVLIQAAAGGVGSLLCQWANALGATVIGTVSTKEKAAQ 248
+MLKG+T Q+LLR+ ++V+PG +L AAAGGVGSL CQWA ALGA +IGTVS+ EKAA
Sbjct: 121 LMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAH 180
Query: 249 AKDDGCHH 256
AK G
Sbjct: 181 AKALGAWE 188
|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Length = 328 | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Length = 330 | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Length = 357 | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Length = 324 | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 256 | |||
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 100.0 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 100.0 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 100.0 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 100.0 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 100.0 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 100.0 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 100.0 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 100.0 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 100.0 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 100.0 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 100.0 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 100.0 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 100.0 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 100.0 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 100.0 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 100.0 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 100.0 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 100.0 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 100.0 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 100.0 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 100.0 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 100.0 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 100.0 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 100.0 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 100.0 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 100.0 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 100.0 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 100.0 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 100.0 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 100.0 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 100.0 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 100.0 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 100.0 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 100.0 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 100.0 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 100.0 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 100.0 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 100.0 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 100.0 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 100.0 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 100.0 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 100.0 | |
| 4eez_A | 348 | Alcohol dehydrogenase 1; site-saturation mutagenes | 100.0 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 100.0 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 100.0 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 100.0 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 100.0 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 100.0 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 100.0 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 100.0 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 100.0 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 100.0 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 100.0 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 100.0 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 100.0 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 100.0 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 100.0 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 100.0 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 100.0 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 100.0 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 100.0 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 100.0 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 100.0 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 100.0 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 100.0 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 100.0 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 100.0 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 100.0 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 100.0 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 99.92 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 99.54 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 98.47 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 97.65 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 97.49 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 97.49 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 97.42 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 97.35 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 97.32 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 97.27 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 97.16 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 97.09 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.93 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 96.92 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 96.85 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 96.77 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 96.73 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 96.68 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 96.67 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 96.63 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 96.57 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 96.55 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 96.54 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 96.49 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 96.47 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 96.46 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 96.45 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 96.45 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 96.39 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 96.39 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 96.39 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 96.38 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 96.38 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 96.36 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 96.35 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 96.34 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 96.33 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 96.32 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 96.31 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 96.31 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 96.31 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 96.3 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.27 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 96.26 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 96.25 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 96.25 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 96.23 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 96.23 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 96.22 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 96.22 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 96.21 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 96.16 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 96.16 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 96.15 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 96.14 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 96.13 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.12 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 96.09 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 96.08 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 96.08 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 96.08 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 96.06 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 96.06 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 96.05 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 96.04 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 96.0 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 96.0 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 95.99 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 95.95 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 95.92 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 95.91 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 95.91 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 95.89 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 95.85 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 95.84 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 95.81 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 95.81 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 95.79 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 95.77 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 95.76 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 95.75 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 95.74 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 95.73 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 95.69 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 95.62 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 95.57 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 95.57 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 95.54 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.53 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 95.52 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 95.51 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 95.45 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 95.44 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 95.43 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 95.38 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 95.33 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 95.32 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 95.31 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.28 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 95.26 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 95.21 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 95.2 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.2 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 95.19 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 95.18 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 95.08 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 95.06 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 95.05 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 95.04 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 95.02 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 94.97 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 94.95 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 94.93 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 94.9 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 94.89 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 94.85 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 94.79 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 94.69 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 94.67 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 94.64 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 94.61 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 94.58 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 94.5 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 94.32 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 94.27 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 94.17 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 94.14 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 94.11 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 94.1 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 94.09 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 94.03 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 93.91 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 93.91 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 93.83 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 93.83 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 93.82 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 93.77 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 93.74 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 93.74 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 93.74 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 93.7 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 93.69 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 93.67 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 93.64 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 93.63 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 93.59 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 93.56 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 93.52 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 93.42 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 93.36 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 93.34 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 93.32 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 93.31 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 93.21 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 93.21 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 93.09 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 93.09 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 93.06 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 93.0 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 92.98 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 92.98 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 92.97 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 92.92 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 92.91 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 92.89 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 92.86 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 92.86 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 92.82 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 92.81 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 92.8 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 92.71 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 92.69 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 92.64 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 92.58 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 92.54 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 92.53 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 92.52 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 92.49 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 92.42 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 92.39 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 92.37 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 92.35 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 92.28 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 92.26 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 92.21 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 92.18 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 92.17 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 92.05 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 92.03 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 92.01 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 91.94 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 91.93 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 91.91 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 91.84 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 91.83 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 91.78 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 91.74 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 91.63 | |
| 3tbh_A | 334 | O-acetyl serine sulfhydrylase; cysteine synthase, | 91.44 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 91.32 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 91.29 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 91.2 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 91.18 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 91.16 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 91.11 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 91.1 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 90.98 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 90.96 | |
| 3vc3_A | 344 | Beta-cyanoalnine synthase; beta-cyanoalanine synth | 90.9 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 90.88 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 90.82 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 90.8 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 90.8 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 90.76 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 90.75 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 90.69 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 90.49 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 90.41 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 90.37 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 90.37 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 90.3 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 90.24 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 90.2 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 90.16 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 90.1 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 90.03 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 89.96 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 89.73 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 89.69 | |
| 2v03_A | 303 | Cysteine synthase B; pyridoxal phosphate, cysteine | 89.56 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 89.5 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 89.47 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 89.4 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 89.4 | |
| 2pqm_A | 343 | Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 | 89.33 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 89.07 | |
| 4fcc_A | 450 | Glutamate dehydrogenase; protein complex, rossmann | 89.01 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 88.97 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 88.93 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 88.88 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 88.77 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 88.76 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 88.71 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 88.67 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 88.6 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 88.46 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 88.37 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 88.36 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 88.3 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 88.19 | |
| 1y7l_A | 316 | O-acetylserine sulfhydrylase, O-acetylserine (thio | 88.08 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 88.01 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 87.99 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 87.99 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 87.94 | |
| 1z7w_A | 322 | Cysteine synthase; transferase; HET: PLP; 2.20A {A | 87.93 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 87.92 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 87.87 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 87.86 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 87.85 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 87.72 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 87.53 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 87.48 | |
| 3dwg_A | 325 | Cysteine synthase B; sulfur carrier protein comple | 87.39 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 87.37 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 87.35 | |
| 2q3b_A | 313 | Cysteine synthase A; pyridoxal-5'-phosphate, sulph | 87.31 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 87.19 | |
| 4aec_A | 430 | Cysteine synthase, mitochondrial; lyase, cysteine | 87.18 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 87.11 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 87.1 | |
| 1jbq_A | 435 | B, cystathionine beta-synthase, serine sulfhydrase | 87.04 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 87.04 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 87.04 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 86.99 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 86.89 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 86.89 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 86.86 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 86.8 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 86.78 | |
| 1bgv_A | 449 | Glutamate dehydrogenase; oxidoreductase; HET: GLU; | 86.7 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 86.48 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 86.46 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 86.39 | |
| 2egu_A | 308 | Cysteine synthase; O-acetylserine sulfhydrase, str | 86.31 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 86.03 | |
| 4hv4_A | 494 | UDP-N-acetylmuramate--L-alanine ligase; MURC, yers | 85.92 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 85.88 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 85.73 | |
| 3hn7_A | 524 | UDP-N-acetylmuramate-L-alanine ligase; ATP-binding | 85.6 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 85.6 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 85.57 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 85.56 | |
| 2we8_A | 386 | Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc | 85.5 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 85.43 | |
| 2yfq_A | 421 | Padgh, NAD-GDH, NAD-specific glutamate dehydrogena | 85.32 | |
| 3k92_A | 424 | NAD-GDH, NAD-specific glutamate dehydrogenase; ROC | 85.01 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 84.98 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 84.96 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 84.88 | |
| 3nx6_A | 95 | 10KDA chaperonin; bacterial blight, XOO4289, groes | 84.76 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 84.6 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 84.53 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 84.42 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 84.39 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 84.38 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 84.34 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 84.08 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 84.07 | |
| 1ve1_A | 304 | O-acetylserine sulfhydrylase; PLP, transferase, ri | 83.93 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 83.86 | |
| 3on5_A | 362 | BH1974 protein; structural genomics, joint center | 83.84 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 83.81 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 83.61 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 83.54 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 83.51 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 83.48 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 83.38 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 83.31 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 83.26 | |
| 2zsj_A | 352 | Threonine synthase; PLP dependent enzyme, lyase; H | 83.23 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 83.11 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 83.08 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 82.99 | |
| 2tmg_A | 415 | Protein (glutamate dehydrogenase); metabolic role, | 82.98 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 82.9 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 82.87 | |
| 1v9l_A | 421 | Glutamate dehydrogenase; protein-NAD complex, oxid | 82.81 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 82.75 | |
| 1g31_A | 111 | GP31; chaperone, CO-chaperonin, groes, in VIVO pro | 82.74 | |
| 3aey_A | 351 | Threonine synthase; PLP, pyridoxal phosphate, lyas | 82.72 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 82.36 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 82.31 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 82.29 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 82.22 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 82.05 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 81.78 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 81.68 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 81.58 | |
| 2d1f_A | 360 | Threonine synthase; amino acid synthesis, pyridoxa | 81.18 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 81.08 | |
| 1j0a_A | 325 | 1-aminocyclopropane-1-carboxylate deaminase; PLP d | 81.02 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 81.02 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 80.99 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 80.94 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 80.89 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 80.81 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 80.79 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 80.77 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 80.75 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 80.68 | |
| 1ve5_A | 311 | Threonine deaminase; riken structural genomics/Pro | 80.5 | |
| 1p5j_A | 372 | L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo | 80.46 | |
| 1tzj_A | 338 | ACC deaminase, 1-aminocyclopropane-1-carboxylate d | 80.38 | |
| 2rkb_A | 318 | Serine dehydratase-like; PLP bound enzyme, enzyme | 80.26 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 80.24 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 80.23 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 80.13 |
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-42 Score=301.95 Aligned_cols=188 Identities=51% Similarity=0.816 Sum_probs=180.0
Q ss_pred ceEEEEEcccCCCCceEEEEeeCCCCCCCeEEEEEeEEeeChhhhHhHhCCCCCCCCCCCCCcccEEEEEEeCCCCCccC
Q 036416 69 MVKAIRVYEHGDPEVLKWEDVEIGEPGEGEIRVRNKAIGLNFIDVYYRKGVYKPAKMPFTPGMEAVGEVVAVGPGLTGRT 148 (256)
Q Consensus 69 ~~~a~~~~~~~~~~~l~~~~~~~p~~~~~eVlVkv~~~~i~~~D~~~~~g~~~~~~~p~~lG~e~~G~V~~vG~~v~~~~ 148 (256)
+|||+++++++.++.+++++.+.|+|++|||+|||.+++||++|++++.|.++...+|.++|||++|+|+++|++|++|+
T Consensus 1 MMkA~~~~~~g~~~~l~~~~~~~p~~~~~eVlVkv~a~gi~~~D~~~~~g~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~ 80 (325)
T 3jyn_A 1 MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFK 80 (325)
T ss_dssp CEEEEEBSSCSSGGGCEEEEECCCCCCTTEEEEEEEEEECCHHHHHHHHTSSCCSSSSBCCCCCEEEEEEEECTTCCSCC
T ss_pred CcEEEEEecCCCcceeEEeecCCCCCCCCEEEEEEEEEecCHHHHHHHCCCCCCCCCCCCCCceeEEEEEEECCCCCCCC
Confidence 39999999999999999999999999999999999999999999999999887767899999999999999999999999
Q ss_pred CCCEEEEeCCCCcceeeEEEecCCCeEECCCCCCHHHHhhhchhHHHHHHHHHHHcCCCCCCEEEEecCCChHHHHHHHH
Q 036416 149 VGDIIAYAGGAMGSYAEEQILPANKVVPVPSSIDPVIAASIMLKGMTAQFLLRRCFKVEPGHTVLIQAAAGGVGSLLCQW 228 (256)
Q Consensus 149 ~Gd~V~~~~~~~G~~a~~~~v~~~~~~~ip~~~~~~~aa~l~~~~~ta~~~l~~~~~~~~g~~VlI~ga~g~vG~~ai~l 228 (256)
+||||++....+|+|+||+++|.+.++++|+++++++|+++++.++|||+++.+.+++++|++|||+||+|++|++++|+
T Consensus 81 ~GdrV~~~~~~~G~~aey~~v~~~~~~~~P~~~~~~~aa~l~~~~~ta~~~l~~~~~~~~g~~VlV~Ga~g~iG~~~~~~ 160 (325)
T 3jyn_A 81 VGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQW 160 (325)
T ss_dssp TTCEEEESSSSSCCSBSEEEEEGGGEEECCTTSCHHHHHHHHHHHHHHHHHHHTTSCCCTTCEEEESSTTSHHHHHHHHH
T ss_pred CCCEEEEecCCCccccceEEecHHHeEECCCCCCHHHHhhhhhhHHHHHHHHHHhcCCCCCCEEEEEcCCcHHHHHHHHH
Confidence 99999988766799999999999999999999999999999999999999999888999999999999999999999999
Q ss_pred HHHcCCeEEEEeCChhhHHHHHhCCCCC
Q 036416 229 ANALGATVIGTVSTKEKAAQAKDDGCHH 256 (256)
Q Consensus 229 a~~~ga~Vi~~~~~~~~~~~~~~~Ga~~ 256 (256)
|+..|++|++++++++|+++++++|+++
T Consensus 161 a~~~Ga~Vi~~~~~~~~~~~~~~~Ga~~ 188 (325)
T 3jyn_A 161 AKALGAKLIGTVSSPEKAAHAKALGAWE 188 (325)
T ss_dssp HHHHTCEEEEEESSHHHHHHHHHHTCSE
T ss_pred HHHCCCEEEEEeCCHHHHHHHHHcCCCE
Confidence 9999999999999999999999999873
|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
| >3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} SCOP: b.35.1.0 | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1g31_A GP31; chaperone, CO-chaperonin, groes, in VIVO protein folding, bacteriophage T4; 2.30A {Enterobacteria phage T4} SCOP: b.35.1.1 PDB: 2cgt_O | Back alignment and structure |
|---|
| >3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* | Back alignment and structure |
|---|
| >1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* | Back alignment and structure |
|---|
| >2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 256 | ||||
| d1yb5a1 | 150 | b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas | 6e-23 | |
| d1qora1 | 147 | b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductas | 8e-23 | |
| d1tt7a1 | 162 | b.35.1.2 (A:2-127,A:295-330) Hypothetical protein | 3e-22 | |
| d1xa0a1 | 152 | b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo | 9e-21 | |
| d2fzwa1 | 197 | b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase | 1e-20 | |
| d1llua1 | 175 | b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase | 2e-19 | |
| d1cdoa1 | 199 | b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase | 5e-19 | |
| d1o89a1 | 146 | b.35.1.2 (A:1-115,A:293-323) Hypothetical protein | 1e-18 | |
| d1piwa1 | 192 | b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy | 1e-17 | |
| d1gu7a1 | 175 | b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu | 4e-17 | |
| d1iz0a1 | 131 | b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase | 6e-17 | |
| d1pl8a1 | 185 | b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor | 2e-16 | |
| d1jvba1 | 177 | b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase | 4e-15 | |
| d1e3ja1 | 178 | b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor | 2e-14 | |
| d1kola1 | 201 | b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog | 6e-13 | |
| d1f8fa1 | 194 | b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr | 7e-13 | |
| d1rjwa1 | 171 | b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase | 9e-13 | |
| d1e3ia1 | 202 | b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase | 2e-12 | |
| d2jhfa1 | 198 | b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase | 2e-12 | |
| d1uufa1 | 179 | b.35.1.2 (A:3-144,A:313-349) Hypothetical protein | 5e-12 | |
| d1vj0a1 | 184 | b.35.1.2 (A:2-155,A:338-367) Hypothetical protein | 2e-11 | |
| d1p0fa1 | 198 | b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro | 4e-11 | |
| d1h2ba1 | 171 | b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas | 5e-11 | |
| d1vj1a1 | 166 | b.35.1.2 (A:-1-124,A:312-351) Putative zinc-bindin | 1e-10 | |
| d1gu7a2 | 189 | c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yea | 2e-10 | |
| d1v3va2 | 182 | c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehyd | 2e-09 | |
| d1o8ca2 | 77 | c.2.1.1 (A:116-192) Hypothetical protein YhdH {Esc | 2e-09 | |
| d1jqba1 | 177 | b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon | 4e-09 | |
| d1qora2 | 179 | c.2.1.1 (A:113-291) Quinone oxidoreductase {Escher | 7e-09 | |
| d1vj1a2 | 187 | c.2.1.1 (A:125-311) Putative zinc-binding alcohol | 2e-08 | |
| d1v3va1 | 147 | b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hyd | 2e-08 | |
| d2jhfa2 | 176 | c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( | 8e-08 | |
| d2fzwa2 | 176 | c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( | 3e-07 | |
| d1tt7a2 | 167 | c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bac | 4e-07 | |
| d1vj0a2 | 182 | c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T | 8e-07 | |
| d1llua2 | 166 | c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudom | 3e-06 | |
| d1p0fa2 | 174 | c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog | 7e-06 | |
| d1pqwa_ | 183 | c.2.1.1 (A:) Putative enoyl reductase domain of po | 9e-06 | |
| d1piwa2 | 168 | c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase | 1e-05 | |
| d1jvba2 | 170 | c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeo | 2e-05 | |
| d1rjwa2 | 168 | c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu | 2e-05 | |
| d1xa0a2 | 176 | c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Ba | 3e-05 | |
| d1yb5a2 | 174 | c.2.1.1 (A:121-294) Quinone oxidoreductase {Human | 1e-04 | |
| d1cdoa2 | 175 | c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga | 2e-04 | |
| d1f8fa2 | 174 | c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { | 3e-04 | |
| d1e3ia2 | 174 | c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( | 7e-04 | |
| d1uufa2 | 168 | c.2.1.1 (A:145-312) Hypothetical protein YahK {Esc | 0.001 | |
| d1iz0a2 | 171 | c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus | 0.002 | |
| d1d1ta2 | 176 | c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( | 0.002 | |
| d1y1pa1 | 342 | c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo | 0.002 | |
| d1o89a2 | 177 | c.2.1.1 (A:116-292) Hypothetical protein YhdH {Esc | 0.002 |
| >d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
class: All beta proteins fold: GroES-like superfamily: GroES-like family: Alcohol dehydrogenase-like, N-terminal domain domain: Quinone oxidoreductase species: Human (Homo sapiens) [TaxId: 9606]
Score = 89.3 bits (220), Expect = 6e-23
Identities = 41/148 (27%), Positives = 72/148 (48%), Gaps = 2/148 (1%)
Query: 69 MVKAIRVYEHGDPEVLKWE-DVEIGEPGEGEIRVRNKAIGLNFIDVYYRKGVYK-PAKMP 126
+++A+RV+E G PEVLK D+ + P + ++ ++ A G+N ++ Y R G Y +P
Sbjct: 2 LMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLP 61
Query: 127 FTPGMEAVGEVVAVGPGLTGRTVGDIIAYAGGAMGSYAEEQILPANKVVPVPSSIDPVIA 186
+TPG + G + AVG + GD + + G YAE + + V +P + PVI
Sbjct: 62 YTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLKPVIG 121
Query: 187 ASIMLKGMTAQFLLRRCFKVEPGHTVLI 214
+ L+ + G +L+
Sbjct: 122 SQYPLEKVAEAHENIIHGSGATGKMILL 149
|
| >d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 147 | Back information, alignment and structure |
|---|
| >d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 | Back information, alignment and structure |
|---|
| >d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 | Back information, alignment and structure |
|---|
| >d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
| >d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 | Back information, alignment and structure |
|---|
| >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 | Back information, alignment and structure |
|---|
| >d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 146 | Back information, alignment and structure |
|---|
| >d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 | Back information, alignment and structure |
|---|
| >d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 | Back information, alignment and structure |
|---|
| >d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 | Back information, alignment and structure |
|---|
| >d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 | Back information, alignment and structure |
|---|
| >d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 | Back information, alignment and structure |
|---|
| >d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 | Back information, alignment and structure |
|---|
| >d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 | Back information, alignment and structure |
|---|
| >d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 | Back information, alignment and structure |
|---|
| >d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 | Back information, alignment and structure |
|---|
| >d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 | Back information, alignment and structure |
|---|
| >d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 | Back information, alignment and structure |
|---|
| >d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 | Back information, alignment and structure |
|---|
| >d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 | Back information, alignment and structure |
|---|
| >d1vj1a1 b.35.1.2 (A:-1-124,A:312-351) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 166 | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 189 | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 182 | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 77 | Back information, alignment and structure |
|---|
| >d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 187 | Back information, alignment and structure |
|---|
| >d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 147 | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 167 | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 168 | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 170 | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 176 | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 168 | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 171 | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 177 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 256 | |||
| d1yb5a1 | 150 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 100.0 | |
| d1qora1 | 147 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 99.97 | |
| d1e3ja1 | 178 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 99.97 | |
| d1llua1 | 175 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 99.97 | |
| d1cdoa1 | 199 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 99.97 | |
| d2fzwa1 | 197 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.97 | |
| d1piwa1 | 192 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 99.97 | |
| d1e3ia1 | 202 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 99.96 | |
| d1xa0a1 | 152 | B. subtilis YhfP homologue {Bacillus stearothermop | 99.96 | |
| d1h2ba1 | 171 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 99.96 | |
| d1f8fa1 | 194 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 99.96 | |
| d1rjwa1 | 171 | Alcohol dehydrogenase {Bacillus stearothermophilus | 99.96 | |
| d1iz0a1 | 131 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 99.96 | |
| d1pl8a1 | 185 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 99.96 | |
| d1vj0a1 | 184 | Hypothetical protein TM0436 {Thermotoga maritima [ | 99.96 | |
| d1jvba1 | 177 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 99.95 | |
| d2jhfa1 | 198 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 99.95 | |
| d1tt7a1 | 162 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 99.94 | |
| d1kola1 | 201 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 99.94 | |
| d1jqba1 | 177 | Bacterial secondary alcohol dehydrogenase {Clostri | 99.94 | |
| d1gu7a1 | 175 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 99.94 | |
| d1o89a1 | 146 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.94 | |
| d1p0fa1 | 198 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 99.94 | |
| d1uufa1 | 179 | Hypothetical protein YahK {Escherichia coli [TaxId | 99.93 | |
| d1vj1a1 | 166 | Putative zinc-binding alcohol dehydrogenase {Mouse | 99.75 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 99.71 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 99.71 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.7 | |
| d1v3va1 | 147 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 99.7 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 99.68 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 99.67 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 99.63 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 99.62 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.6 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 99.58 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.58 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 99.57 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 99.57 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 99.57 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 99.57 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.56 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 99.56 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 99.54 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 99.53 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 99.53 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 99.53 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 99.52 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 99.49 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 99.47 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 99.45 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 99.41 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 99.41 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 99.4 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 99.38 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 99.35 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 97.38 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 97.24 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 97.1 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 96.88 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 96.73 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 96.59 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 96.39 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 96.38 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 96.27 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 95.82 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 95.62 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 95.43 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 95.33 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 95.32 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 95.22 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 95.19 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 95.07 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 95.06 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 94.89 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 94.68 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 94.65 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 94.53 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 94.4 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 94.15 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 94.0 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 93.93 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 93.93 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 93.75 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 93.66 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 93.36 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 93.35 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 93.28 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.23 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 93.2 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 92.92 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 92.84 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 92.83 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 92.8 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 92.77 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 92.58 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 92.51 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 92.18 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 92.02 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 91.88 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 91.84 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 91.74 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 91.7 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 91.62 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 91.57 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 91.45 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 91.44 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 91.36 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 91.11 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 91.1 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 91.07 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 91.02 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 90.92 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 90.91 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 90.88 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 90.76 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 90.73 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 90.69 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 90.65 | |
| d2bhsa1 | 292 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 90.57 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 90.37 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 90.08 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 89.98 | |
| d1jbqa_ | 355 | Cystathionine beta-synthase {Human (Homo sapiens) | 89.83 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 89.82 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 89.67 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 89.59 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 89.57 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 89.53 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 89.44 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 89.2 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 89.19 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 89.19 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 89.1 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 88.6 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 88.52 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 88.41 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 88.11 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 87.78 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 87.54 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 87.5 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 87.41 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 87.23 | |
| d1wkva1 | 382 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 86.79 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 86.52 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 86.17 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 85.87 | |
| d1z7wa1 | 320 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 85.24 | |
| d1y7la1 | 310 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 85.23 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 84.7 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 84.69 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 84.36 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 83.79 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 83.79 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 83.63 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 83.16 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 82.93 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 82.86 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 82.68 | |
| d1tdja1 | 331 | Threonine deaminase {Escherichia coli [TaxId: 562] | 82.55 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 82.49 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 82.09 | |
| d1fcja_ | 302 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 82.07 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 81.72 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 81.38 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 81.29 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 80.67 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 80.56 |
| >d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: GroES-like superfamily: GroES-like family: Alcohol dehydrogenase-like, N-terminal domain domain: Quinone oxidoreductase species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.3e-33 Score=220.27 Aligned_cols=147 Identities=28% Similarity=0.503 Sum_probs=138.2
Q ss_pred ceEEEEEcccCCCCceEEE-EeeCCCCCCCeEEEEEeEEeeChhhhHhHhCCCCC-CCCCCCCCcccEEEEEEeCCCCCc
Q 036416 69 MVKAIRVYEHGDPEVLKWE-DVEIGEPGEGEIRVRNKAIGLNFIDVYYRKGVYKP-AKMPFTPGMEAVGEVVAVGPGLTG 146 (256)
Q Consensus 69 ~~~a~~~~~~~~~~~l~~~-~~~~p~~~~~eVlVkv~~~~i~~~D~~~~~g~~~~-~~~p~~lG~e~~G~V~~vG~~v~~ 146 (256)
.|||++++++|+|+.++++ +++.|+|++|||||||.+++||++|++.+.|.++. ..+|.++|||++|+|+++|+++++
T Consensus 2 ~MkAv~~~~~G~p~~l~~~~~~~~P~~~~~eVlVkv~a~~i~~~D~~~~~g~~~~~~~~p~i~G~e~~G~V~~vG~~v~~ 81 (150)
T d1yb5a1 2 LMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASA 81 (150)
T ss_dssp EEEEEEESSCSSGGGEEEEEEEECCCCCTTEEEEEEEEEECCHHHHHHHHTCSSCCCCSSBCCCSCEEEEEEEECTTCTT
T ss_pred ceeEEEEEccCCcceEEEEeecCCCCCCCCeEEEEEEEecCcccchhhhcCCcCccccccccCccceeeeeEeecceeec
Confidence 5999999999999999986 68999999999999999999999999999997765 467899999999999999999999
Q ss_pred cCCCCEEEEeCCCCcceeeEEEecCCCeEECCCCCCHHHHhhhchhHHHHHHHHHHHcCCCCCCEEEEe
Q 036416 147 RTVGDIIAYAGGAMGSYAEEQILPANKVVPVPSSIDPVIAASIMLKGMTAQFLLRRCFKVEPGHTVLIQ 215 (256)
Q Consensus 147 ~~~Gd~V~~~~~~~G~~a~~~~v~~~~~~~ip~~~~~~~aa~l~~~~~ta~~~l~~~~~~~~g~~VlI~ 215 (256)
|++||||++....+|+|+||++++++.++++|+++++++||+++++.+|+|+.+...+..+.|+++||.
T Consensus 82 ~~vGdrV~~~~~~~G~~ae~~~v~~~~~~~iP~~ls~~~Aa~~~~~~~ta~~~~~~~g~~~~G~~vliL 150 (150)
T d1yb5a1 82 FKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL 150 (150)
T ss_dssp CCTTCEEEESCCSSCSSBSEEEEEGGGEEECCTTCCCCEEEEEEGGGHHHHHHHHHHSSCCSSEEEEEC
T ss_pred cccCccccccccccccccccccccccccccccCCCCHHHHHHhhhhhhhehhhheEEcCcccCCEEEEC
Confidence 999999999888789999999999999999999999999999999999999999888999999999984
|
| >d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|