Citrus Sinensis ID: 036427

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530------
MMQNPSTVSQESAPLFDLVAQVGRFAFSSRFFNSSSDEYASFKSNYLYFDSFKSSIGQRKRNCKVSAASSFSLRSGKGSSVGSFNVSRIVNEFNKAIKFHCERLPIGFASVGINSSERNGIRDENGGVLEDEGLPLNGIENDQPKKVLILMSDTGGGHRASAEAIKAAFHEKFGNEYQVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAPRVIHQSNFAATSTFIAREVAKGLMKYQPDIIISVHPLMQHVPLRILRAKGLLKKIVFTTVITDLSTCHPTWFHKLVTRCYCPTADVAKRAMKAGLQASQIKVYGLPVRPSFVKPVRPKVELRRELGMDEDLPAVLLMGGGEGMGPIEATARALGNALYDENLGEPIGQVLVICGRNKKLANKLLSTDWKIPVQVKGFVSKMEEAMGACDCIITKAGPGTIAEAMIRGLPIILNDFIAGQEAGNVPYVVENGCGKFSKSPKEIANMVSQWFGPKIDELKAMSQNALKLARPDAVFRIVQDLHELVRQRNFVPHYSCVT
ccccccccccccccccHHHHHcccEEEcccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHccccccccEEEEEccccccccccccccccEEEEccHHHHHHHHHHccccccEEECccccccccccccccHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHcccccccEEEEccHHHHHHHHHHccEEECccccHHHHHHHHHcccEEEEccccccHHHHHHHHHHcccEEEcccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccc
************A*LFDLVAQVGRFAFSSRFFNSSSDEYASFKSNYLYFDSFKSSI**************************SFNVSRIVNEFNKAIKFHCERLPIGFASVGIN********************************VLILMSDTGGGHRASAEAIKAAFHEKFGNEYQVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAPRVIHQSNFAATSTFIAREVAKGLMKYQPDIIISVHPLMQHVPLRILRAKGLLKKIVFTTVITDLSTCHPTWFHKLVTRCYCPTADVAKRAMKAGLQASQIKVYGLPVRPSFVKPVRPKVELRRELGMDEDLPAVLLMGGGEGMGPIEATARALGNALYDENLGEPIGQVLVICGRNKKLANKLLSTDWKIPVQVKGFVSKMEEAMGACDCIITKAGPGTIAEAMIRGLPIILNDFIAGQEAGNVPYVVENGCGKFSKSPKEIANMVSQWFGPKIDELKAMSQNALKLARPDAVFRIVQDLHELVRQRNFVPHYSC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMQNPSTVSQESAPLFDLVAQVGRFAFSSRFFNSSSDEYASFKSNYLYFDSFKSSIGQRKRNCKVSAASSFSLRSGKGSSVGSFNVSRIVNEFNKAIKFHCERLPIGFASVGINSSERNGIRDENGGVLEDEGLPLNGIENDQPKKVLILMSDTGGGHRASAEAIKAAFHEKFGNEYQVFVTDLWSDHTPWPFNQLPRSYNFLVKHGPLWKMTYYGTAPRVIHQSNFAATSTFIAREVAKGLMKYQPDIIISVHPLMQHVPLRILRAKGLLKKIVFTTVITDLSTCHPTWFHKLVTRCYCPTADVAKRAMKAGLQASQIKVYGLPVRPSFVKPVRPKVELRRELGMDEDLPAVLLMGGGEGMGPIEATARALGNALYDENLGEPIGQVLVICGRNKKLANKLLSTDWKIPVQVKGFVSKMEEAMGACDCIITKAGPGTIAEAMIRGLPIILNDFIAGQEAGNVPYVVENGCGKFSKSPKEIANMVSQWFGPKIDELKAMSQNALKLARPDAVFRIVQDLHELVRQRNFVPHYSCVT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable monogalactosyldiacylglycerol synthase 1, chloroplastic Involved in the synthesis of the major structural component of photosynthetic membranes.confidentQ69QJ7
Monogalactosyldiacylglycerol synthase 1, chloroplastic Involved in the synthesis of the major structural component of photosynthetic membranes. Required for proper thylakoid membrane biogenesis. Does not discriminate between prokaryotic (18:1/16:0) or eukaryotic (18:2/18:2) 1,2-diacylglycerol species, but operates with some preference for the prokaryotic one.confidentO81770
Probable monogalactosyldiacylglycerol synthase, chloroplastic Involved in the synthesis of the major structural component of photosynthetic membranes.confidentQ9FZL4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.46Monogalactosyldiacylglycerol synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S2U, chain A
Confidence level:very confident
Coverage over the Query: 145-197,225-523
View the alignment between query and template
View the model in PyMOL
Template: 2JJM, chain A
Confidence level:confident
Coverage over the Query: 144-210,222-525
View the alignment between query and template
View the model in PyMOL