Citrus Sinensis ID: 036437

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-

MSSAADQQHKLLSPKSNGAKLLFKDIEVPPRKLLLQNKKSHHHHHHHHHHQDICSGSPRSGSGSGSDSASYLFYPDQQEMNILHNKFLPFNNTDADSDPDSDPYASDHFRMYEFKIRRCTRSRSHDWTDCPFAHPSEKARRRDPRRYHYSGAVCSEYRRGGGCSLGDDCEFAHGVFECWLHPSRYRTEACKDGKNCKRKVCFFAHSPRQLRILPEISSQYSSSPSSVNNNNQKISSHCCMYCHHHSVNSSPTSTLLGNMSHLSRSPSLSPPLSPVKHGLISPISRYSATTPVPADRLSKFSNSSEMSMSYKDVLNELMTSMDAISFNEVSSPMSLTPSNDVNACPWIDVSSFNVEDQQQFVLSPSTPSPSAGSIMNPFAAHHDYFSNKSFLDDDQKMINYHNHIHNNSNGSCQLASDTPDPDLGWVNELLT

ccccHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccEEEcccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccHHHHcccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccc

***********************************************************************LFYPDQQEMNILHNKFLPF***************SDHFRMYEFKIRRCTRSRSHDWTDCPF*H******RRDPRRYHYSGAVCSEYRRGGGCSLGDDCEFAHGVFECWLHPSRYRTEACKDGKNCKRKVCFFAHSPRQLRILPE********************************************************************************************************************************************************************AHHDYFSNKS********************************DLGWVNELLT

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc finger CCCH domain-containing protein 2	Probable transcription repressor that functions as negative regulator of phytochrome-mediated promotion of seed germination. Inhibits seed germination by regulating the expression of gibberellic acid (GA) and abscisic acid (ABA) metabolic genes. Does not regulate the expression of the DELLA genes RGA and RGA1. Activated by PIL5, a phytochrome-interacting basic helix-loop-helix transcription factor.	probable	Q9ZWA1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 113-144
View the alignment between query and template
View the model in PyMOL

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 147-180
View the alignment between query and template
View the model in PyMOL