Citrus Sinensis ID: 036444

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----

SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDYLEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELYKIRYMVPYAEHFVLI

cHHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHccccccHHHHcHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHHcc

ccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHHccEEEc

SLDLIKYvdsnfegpsllpddpekRKFAEELFSysdtfnitvygsfkgdpakeagpcFDYLEKALhkfddgpfllgqlslvdiayiPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQVDAykqtklkdpkglvELYKIRYMVPYAEHFVLI

sldlikyvdsnfegpsllpddpeKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDYLEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQvdaykqtklkdpkglvELYKIRYMVPYAEHFVLI

SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDYLEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELYKIRYMVPYAEHFVLI

***************************AEELFSYSDTFNITVYGSFKGDPAKEAGPCFDYLEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELYKIRYMVPYAEHFVL*

SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDYLEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELYKIRYMVPYAEHFVLI

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDYLEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELYKIRYMVPYAEHFVLI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		154	2.2.26 [Sep-21-2011]
Q9LZ06		235	Glutathione S-transferase	yes	no	0.928	0.608	0.652	6e-49
Q6NLB0		237	Glutathione S-transferase	no	no	0.922	0.599	0.648	6e-46
Q9M2W2		292	Glutathione S-transferase	no	no	0.915	0.482	0.556	8e-42
Q8H8U5		244	Protein IN2-1 homolog B O	yes	no	0.915	0.577	0.590	1e-41
A1XBB7		244	Protein IN2-1 homolog B O	N/A	no	0.915	0.577	0.590	1e-41
Q10N44		243	Protein IN2-1 homolog A O	no	no	0.935	0.592	0.537	2e-37
P49248		243	Protein IN2-1 OS=Zea mays	N/A	no	0.902	0.572	0.5	8e-33
Q9VHD3		246	Probable maleylacetoaceta	yes	no	0.779	0.487	0.268	0.0006

>sp\|Q9LZ06\|GSTL3_ARATH Glutathione S-transferase L3 OS=Arabidopsis thaliana GN=GSTL3 PE=2 SV=1	Back alignment and function desciption

 Score =  192 bits (488), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 115/144 (79%), Gaps = 1/144 (0%)

Query: 1   SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDY 60
           SLDLIKY+D+ FEGPSL P+D  KR+F +EL  Y+DTF  T+Y S KGDP+KE  P  DY
Sbjct: 93  SLDLIKYLDNTFEGPSLYPEDHAKREFGDELLKYTDTFVKTMYVSLKGDPSKETAPVLDY 152

Query: 61  LEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQ 120
           LE AL+KFDDGPF LGQLSLVDIAYIPF+ER Q  L+E+ K DITA RPKL+AWIEE+N+
Sbjct: 153 LENALYKFDDGPFFLGQLSLVDIAYIPFIERFQTVLNELFKCDITAERPKLSAWIEEINK 212

Query: 121 VDAYKQTKLKDPKGLVELYKIRYM 144
            D Y QTK+ DPK +VE++K ++M
Sbjct: 213 SDGYAQTKM-DPKEIVEVFKKKFM 235

Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 8

>sp\|Q6NLB0\|GSTL1_ARATH Glutathione S-transferase L1 OS=Arabidopsis thaliana GN=GSTL1 PE=2 SV=1	Back alignment and function description

>sp\|Q9M2W2\|GSTL2_ARATH Glutathione S-transferase L2, chloroplastic OS=Arabidopsis thaliana GN=GSTL2 PE=2 SV=1	Back alignment and function description

>sp\|Q8H8U5\|IN21B_ORYSJ Protein IN2-1 homolog B OS=Oryza sativa subsp. japonica GN=GSTZ5 PE=2 SV=1	Back alignment and function description

>sp\|A1XBB7\|IN21B_ORYSI Protein IN2-1 homolog B OS=Oryza sativa subsp. indica GN=GSTZ5 PE=1 SV=1	Back alignment and function description

>sp\|Q10N44\|IN21A_ORYSJ Protein IN2-1 homolog A OS=Oryza sativa subsp. japonica GN=Os03g0283200 PE=2 SV=1	Back alignment and function description

>sp\|P49248\|IN21_MAIZE Protein IN2-1 OS=Zea mays GN=IN2-1 PE=2 SV=1	Back alignment and function description

>sp\|Q9VHD3\|MAAI1_DROME Probable maleylacetoacetate isomerase 1 OS=Drosophila melanogaster GN=CG9362 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		154
255568460		242	glutathione-s-transferase omega, putativ	0.935	0.595	0.793	2e-58
283135902		212	lambda class glutathione transferase GST	0.935	0.679	0.780	4e-58
284433794		240	glutathione S-transferase omega [Jatroph	0.935	0.6	0.772	4e-58
224138562		228	predicted protein [Populus trichocarpa]	0.928	0.627	0.786	5e-58
380863048		230	glutathione S-transferase, partial [Dimo	0.928	0.621	0.75	8e-57
297741498		242	unnamed protein product [Vitis vinifera]	0.948	0.603	0.761	2e-55
225439775		236	PREDICTED: glutathione S-transferase L3-	0.935	0.610	0.765	3e-55
225439785		236	PREDICTED: glutathione S-transferase L3	0.896	0.584	0.784	2e-53
224068608		220	predicted protein [Populus trichocarpa]	0.902	0.631	0.773	5e-53
449483626		236	PREDICTED: glutathione S-transferase L3-	0.935	0.610	0.703	4e-52

>gi\|255568460\|ref\|XP_002525204.1\| glutathione-s-transferase omega, putative [Ricinus communis] gi\|223535501\|gb\|EEF37170.1\| glutathione-s-transferase omega, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 125/145 (86%), Gaps = 1/145 (0%)

Query: 1   SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDY 60
           SLDLIKYVDSNFEGPSL PDDP KR+FAEELFSY+DTF+ TV+ SFKGD AKEAGP FDY
Sbjct: 97  SLDLIKYVDSNFEGPSLFPDDPAKREFAEELFSYTDTFSRTVFTSFKGDVAKEAGPAFDY 156

Query: 61  LEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQ 120
           LE AL KFDDGPFLLGQ SLVDIAYIPFVER +IFLSEV KYDITAGRPKLAAW+ E+N+
Sbjct: 157 LENALQKFDDGPFLLGQFSLVDIAYIPFVERLEIFLSEVFKYDITAGRPKLAAWVGEVNK 216

Query: 121 VDAYKQTKLKDPKGLVELYKIRYMV 145
           + AYKQTK  DPK LVE YK R+  
Sbjct: 217 IGAYKQTK-TDPKELVEYYKKRFFA 240

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|283135902\|gb\|ADB11342.1\| lambda class glutathione transferase GSTL2 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|284433794\|gb\|ADB85103.1\| glutathione S-transferase omega [Jatropha curcas]	Back alignment and taxonomy information

>gi\|224138562\|ref\|XP_002322845.1\| predicted protein [Populus trichocarpa] gi\|222867475\|gb\|EEF04606.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|380863048\|gb\|AFF18817.1\| glutathione S-transferase, partial [Dimocarpus longan]	Back alignment and taxonomy information

>gi\|297741498\|emb\|CBI32630.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225439775\|ref\|XP_002275882.1\| PREDICTED: glutathione S-transferase L3-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225439785\|ref\|XP_002276301.1\| PREDICTED: glutathione S-transferase L3 [Vitis vinifera] gi\|297741504\|emb\|CBI32636.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224068608\|ref\|XP_002326157.1\| predicted protein [Populus trichocarpa] gi\|222833350\|gb\|EEE71827.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449483626\|ref\|XP_004156642.1\| PREDICTED: glutathione S-transferase L3-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		154
TAIR\|locus:2151326		235	GSTL3 "Glutathione transferase	0.928	0.608	0.652	2e-47
TAIR\|locus:2151286		237	GSTL1 "AT5G02780" [Arabidopsis	0.922	0.599	0.648	2.7e-45
TAIR\|locus:2097233		292	GSTL2 "glutathione transferase	0.915	0.482	0.556	1.4e-39
FB\|FBgn0037696		246	GstZ1 "Glutathione S transfera	0.779	0.487	0.289	0.0004
TAIR\|locus:2024857		224	GSTU28 "AT1G53680" [Arabidopsi	0.902	0.620	0.263	0.00065
UNIPROTKB\|P78417		241	GSTO1 "Glutathione S-transfera	0.837	0.535	0.312	0.00078
UNIPROTKB\|F1S5N8		193	F1S5N8 "Uncharacterized protei	0.831	0.663	0.298	0.00079
TAIR\|locus:2012773		227	ERD9 "AT1G10370" [Arabidopsis	0.909	0.616	0.302	0.00092

TAIR\|locus:2151326 GSTL3 "Glutathione transferase L3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 496 (179.7 bits), Expect = 2.0e-47, P = 2.0e-47
 Identities = 94/144 (65%), Positives = 115/144 (79%)

Query:     1 SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDY 60
             SLDLIKY+D+ FEGPSL P+D  KR+F +EL  Y+DTF  T+Y S KGDP+KE  P  DY
Sbjct:    93 SLDLIKYLDNTFEGPSLYPEDHAKREFGDELLKYTDTFVKTMYVSLKGDPSKETAPVLDY 152

Query:    61 LEKALHKFDDGPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQ 120
             LE AL+KFDDGPF LGQLSLVDIAYIPF+ER Q  L+E+ K DITA RPKL+AWIEE+N+
Sbjct:   153 LENALYKFDDGPFFLGQLSLVDIAYIPFIERFQTVLNELFKCDITAERPKLSAWIEEINK 212

Query:   121 VDAYKQTKLKDPKGLVELYKIRYM 144
              D Y QTK+ DPK +VE++K ++M
Sbjct:   213 SDGYAQTKM-DPKEIVEVFKKKFM 235

GO:0005737 "cytoplasm" evidence=ISM

GO:0046686 "response to cadmium ion" evidence=IEP;RCA

GO:0005829 "cytosol" evidence=IDA

GO:0019344 "cysteine biosynthetic process" evidence=RCA

GO:0019761 "glucosinolate biosynthetic process" evidence=RCA

GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA

TAIR\|locus:2151286 GSTL1 "AT5G02780" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2097233 GSTL2 "glutathione transferase lambda 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

FB\|FBgn0037696 GstZ1 "Glutathione S transferase Z1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

TAIR\|locus:2024857 GSTU28 "AT1G53680" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|P78417 GSTO1 "Glutathione S-transferase omega-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S5N8 F1S5N8 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

TAIR\|locus:2012773 ERD9 "AT1G10370" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LZ06	GSTL3_ARATH	2, ., 5, ., 1, ., 1, 8	0.6527	0.9285	0.6085	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		154
cd03203		120	cd03203, GST_C_Lambda, C-terminal, alpha helical d	1e-61
cd00299		100	cd00299, GST_C_family, C-terminal, alpha helical d	4e-07
cd03183		126	cd03183, GST_C_Theta, C-terminal, alpha helical do	4e-06
pfam13410		69	pfam13410, GST_C_2, Glutathione S-transferase, C-t	4e-06
COG0625		211	COG0625, Gst, Glutathione S-transferase [Posttrans	2e-04
cd03185		127	cd03185, GST_C_Tau, C-terminal, alpha helical doma	9e-04
cd03205		109	cd03205, GST_C_6, C-terminal, alpha helical domain	0.001

>gnl\|CDD\|198312 cd03203, GST_C_Lambda, C-terminal, alpha helical domain of Class Lambda Glutathione S-transferases	Back alignment and domain information

 Score =  185 bits (472), Expect = 1e-61
 Identities = 79/121 (65%), Positives = 92/121 (76%), Gaps = 2/121 (1%)

Query: 21  DPEKRKFAEELFSYSDTFNITVYGSF-KGDPAKEAGPCFDYLEKALHKFDDGPFLLGQLS 79
           DP KR+FA+EL +Y+DTF   VY +  KGD   EA   FDYLE AL KFDDGPF LGQ S
Sbjct: 1   DPAKREFADELLAYADTFTKAVYSALIKGDMTAEAAAAFDYLENALSKFDDGPFFLGQFS 60

Query: 80  LVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELY 139
           LVDIAY PF+ER QI LSE+  YDITAGRP LA WIEE+N+++AY QTK  DP+ L+ELY
Sbjct: 61  LVDIAYAPFIERFQIVLSELRNYDITAGRPNLAKWIEEMNKIEAYTQTK-VDPEELLELY 119

Query: 140 K 140
           K
Sbjct: 120 K 120

Glutathione S-transferase (GST) C-terminal domain family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs. GSTs are cytosolic, usually dimeric, proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Lambda subfamily was recently discovered, together with dehydroascorbate reductases (DHARs), as two outlying groups of the GST superfamily in Arabidopsis thaliana, which contain conserved active site cysteines. Characterization of recombinant A. thaliana proteins show that Lambda class GSTs are monomeric, similar to DHARs. They do not exhibit GSH conjugating or DHAR activities, but are active as thiol transferases, similar to glutaredoxins. Members of this subfamily were originally identified as encoded proteins of the In2-1 gene, which can be induced by treatment with herbicide safeners. Length = 120

>gnl\|CDD\|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family	Back alignment and domain information

>gnl\|CDD\|198292 cd03183, GST_C_Theta, C-terminal, alpha helical domain of Class Theta Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|198294 cd03185, GST_C_Tau, C-terminal, alpha helical domain of Class Tau Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198314 cd03205, GST_C_6, C-terminal, alpha helical domain of an unknown subfamily 6 of Glutathione S-transferases	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		154
KOG0406		231	consensus Glutathione S-transferase [Posttranslati	99.88
PRK09481		211	sspA stringent starvation protein A; Provisional	99.84
TIGR00862		236	O-ClC intracellular chloride channel protein. Thes	99.82
PRK10542		201	glutathionine S-transferase; Provisional	99.81
TIGR01262		210	maiA maleylacetoacetate isomerase. Maleylacetoacet	99.8
KOG0868		217	consensus Glutathione S-transferase [Posttranslati	99.8
PLN02817		265	glutathione dehydrogenase (ascorbate)	99.78
PLN02473		214	glutathione S-transferase	99.77
PLN02395		215	glutathione S-transferase	99.77
PRK10357		202	putative glutathione S-transferase; Provisional	99.77
PRK13972		215	GSH-dependent disulfide bond oxidoreductase; Provi	99.77
PRK15113		214	glutathione S-transferase; Provisional	99.76
cd03203		120	GST_C_Lambda GST_C family, Class Lambda subfamily;	99.76
PRK11752		264	putative S-transferase; Provisional	99.73
COG0625		211	Gst Glutathione S-transferase [Posttranslational m	99.73
PLN02378		213	glutathione S-transferase DHAR1	99.72
cd03190		142	GST_C_ECM4_like GST_C family, ECM4-like subfamily;	99.71
cd03184		124	GST_C_Omega GST_C family, Class Omega subfamily; G	99.71
PTZ00057		205	glutathione s-transferase; Provisional	99.66
cd03185		126	GST_C_Tau GST_C family, Class Tau subfamily; GSTs	99.66
cd03186		107	GST_C_SspA GST_N family, Stringent starvation prot	99.64
cd03196		115	GST_C_5 GST_C family, unknown subfamily 5; compose	99.62
cd03201		121	GST_C_DHAR GST_C family, Dehydroascorbate Reductas	99.61
cd03198		134	GST_C_CLIC GST_C family, Chloride Intracellular Ch	99.6
PLN02907		722	glutamate-tRNA ligase	99.6
PRK10387		210	glutaredoxin 2; Provisional	99.58
KOG0867		226	consensus Glutathione S-transferase [Posttranslati	99.58
cd03188		114	GST_C_Beta GST_C family, Class Beta subfamily; GST	99.57
KOG1695		206	consensus Glutathione S-transferase [Posttranslati	99.54
cd03191		121	GST_C_Zeta GST_C family, Class Zeta subfamily; GST	99.53
cd03182		117	GST_C_GTT2_like GST_C family, Saccharomyces cerevi	99.51
cd03178		113	GST_C_Ure2p_like GST_C family, Ure2p-like subfamil	99.5
cd03200		96	GST_C_JTV1 GST_C family, JTV-1 subfamily; composed	99.48
cd03209		121	GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar	99.48
cd03177		118	GST_C_Delta_Epsilon GST_C family, Class Delta and	99.48
cd03189		119	GST_C_GTT1_like GST_C family, Saccharomyces cerevi	99.47
TIGR02182		209	GRXB Glutaredoxin, GrxB family. This model include	99.47
cd03210		126	GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar	99.46
cd03195		114	GST_C_4 GST_C family, unknown subfamily 4; compose	99.45
cd03187		118	GST_C_Phi GST_C family, Class Phi subfamily; compo	99.45
cd03208		137	GST_C_Alpha GST_C family, Class Alpha subfamily; G	99.45
PF00043		95	GST_C: Glutathione S-transferase, C-terminal domai	99.44
cd03207		103	GST_C_8 GST_C family, unknown subfamily 8; compose	99.42
cd03180		110	GST_C_2 GST_C family, unknown subfamily 2; compose	99.41
cd03181		123	GST_C_EFB1gamma GST_C family, Gamma subunit of Elo	99.4
cd03183		126	GST_C_Theta GST_C family, Class Theta subfamily; c	99.37
cd03204		111	GST_C_GDAP1 GST_C family, Ganglioside-induced diff	99.35
KOG1422		221	consensus Intracellular Cl- channel CLIC, contains	99.32
PF13410		69	GST_C_2: Glutathione S-transferase, C-terminal dom	99.29
cd03206		100	GST_C_7 GST_C family, unknown subfamily 7; compose	99.28
cd03179		105	GST_C_1 GST_C family, unknown subfamily 1; compose	99.24
cd03194		114	GST_C_3 GST_C family, unknown subfamily 3; compose	99.2
KOG2903		319	consensus Predicted glutathione S-transferase [Pos	99.17
COG0435		324	ECM4 Predicted glutathione S-transferase [Posttran	99.17
cd03202		124	GST_C_etherase_LigE GST_C family, Beta etherase Li	99.17
cd03192		104	GST_C_Sigma_like GST_C family, Class Sigma_like; c	99.15
PF14497		99	GST_C_3: Glutathione S-transferase, C-terminal dom	99.1
cd03193		88	GST_C_Metaxin GST_C family, Metaxin subfamily; com	99.05
PF14834		117	GST_C_4: Glutathione S-transferase, C-terminal dom	99.03
cd00299		100	GST_C_family Glutathione S-transferase (GST) famil	98.99
KOG4420		325	consensus Uncharacterized conserved protein (Gangl	98.96
cd03197		149	GST_C_mPGES2 GST_C family; microsomal Prostaglandi	98.91
cd03205		98	GST_C_6 GST_C family, unknown subfamily 6; compose	98.72
cd03211		126	GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me	98.66
cd03212		137	GST_C_Metaxin1_3 GST_C family, Metaxin subfamily,	98.57
KOG4244		281	consensus Failed axon connections (fax) protein/gl	97.91
cd03199		128	GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub	97.37
PF04399		132	Glutaredoxin2_C: Glutaredoxin 2, C terminal domain	97.31
COG2999		215	GrxB Glutaredoxin 2 [Posttranslational modificatio	97.26
KOG3029		370	consensus Glutathione S-transferase-related protei	97.24
KOG3027		257	consensus Mitochondrial outer membrane protein Met	96.7
KOG1147		712	consensus Glutamyl-tRNA synthetase [Translation, r	96.0
KOG3028		313	consensus Translocase of outer mitochondrial membr	94.26
PF11801		168	Tom37_C: Tom37 C-terminal domain; InterPro: IPR019	80.75

>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.88  E-value=1.3e-21  Score=139.42  Aligned_cols=144  Identities=29%  Similarity=0.402  Sum_probs=118.4

Q ss_pred             ChHHHHHHHhcCC-CCCCCCCCHHHHHHHHHHhhhhcc-c--chhhhcc-ccCC----chhhhhhHHHHHHHHhhcCCCC
Q 036444            1 SLDLIKYVDSNFE-GPSLLPDDPEKRKFAEELFSYSDT-F--NITVYGS-FKGD----PAKEAGPCFDYLEKALHKFDDG   71 (154)
Q Consensus         1 S~aI~~yL~~~~~-~~~L~p~~~~~~a~~~~~~~~~~~-~--~~~~~~~-~~~~----~~~~~~~~l~~le~~L~~~~~~   71 (154)
                      |..|++||++.+| +++++|+||.+|++.+.|..+++. .  ....+.. ..++    +.+++.+.+..||+.|.+  ++
T Consensus        72 SliiveYiDe~w~~~~~iLP~DPy~Ra~arfwa~~id~~~~~~~~~~~~~~~~e~~~~~~~e~~e~l~~lE~el~k--~k  149 (231)
T KOG0406|consen   72 SLIIVEYIDETWPSGPPILPSDPYERAQARFWAEYIDKKVFFVGRFVVAAKGGEEQEAAKEELREALKVLEEELGK--GK  149 (231)
T ss_pred             hHHHHHHHHhhccCCCCCCCCCHHHHHHHHHHHHHHHhHHHHHHHHHHhhcCchHHHHHHHHHHHHHHHHHHHHhc--CC
Confidence            7899999999999 689999999999999999999996 1  2222222 2222    456799999999999994  78


Q ss_pred             CeeecC-CcHHHHHHhhHHHHHHHHhccccc--cccccCCchHHHHHHHHhcchhhhhcccCChhhHHHHHHHHhhccc
Q 036444           72 PFLLGQ-LSLVDIAYIPFVERAQIFLSEVIK--YDITAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELYKIRYMVPY  147 (154)
Q Consensus        72 ~fl~G~-~t~ADi~~~~~l~~~~~~~~~~~~--~~~~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  147 (154)
                      +|++|+ +|+.|++++|++.+.........+  ......+|+|.+|.++|.++|+|+++++ +.+.+.++.++++.+..
T Consensus       150 ~~fgG~~~G~vDi~~~p~~~~~~~~~~~~~~~~~~~~~~~P~L~~W~~~~~~~~~V~~~~p-~~e~~~e~~~~~~~~~~  227 (231)
T KOG0406|consen  150 DFFGGETIGFVDIAIGPSFERWLAVLEKFGGVKFIIEEETPKLIKWIKRMKEDEAVKAVLP-DSEKVVEFMKKYRQGSP  227 (231)
T ss_pred             CCCCCCCcCHhhhhHHhhHHHHHHHHHHhcCcccCCCCCCccHHHHHHHHhcChhHHhhcC-CHHHHHHHHHHHHHhcc
Confidence            999999 999999999888777665433332  2334688999999999999999999999 99999999999998754

>PRK09481 sspA stringent starvation protein A; Provisional	Back alignment and domain information

>TIGR00862 O-ClC intracellular chloride channel protein	Back alignment and domain information

>PRK10542 glutathionine S-transferase; Provisional	Back alignment and domain information

>TIGR01262 maiA maleylacetoacetate isomerase	Back alignment and domain information

>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02817 glutathione dehydrogenase (ascorbate)	Back alignment and domain information

>PLN02473 glutathione S-transferase	Back alignment and domain information

>PLN02395 glutathione S-transferase	Back alignment and domain information

>PRK10357 putative glutathione S-transferase; Provisional	Back alignment and domain information

>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional	Back alignment and domain information

>PRK15113 glutathione S-transferase; Provisional	Back alignment and domain information

>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs	Back alignment and domain information

>PRK11752 putative S-transferase; Provisional	Back alignment and domain information

>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02378 glutathione S-transferase DHAR1	Back alignment and domain information

>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4	Back alignment and domain information

>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>PTZ00057 glutathione s-transferase; Provisional	Back alignment and domain information

>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant	Back alignment and domain information

>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins	Back alignment and domain information

>PLN02907 glutamate-tRNA ligase	Back alignment and domain information

>PRK10387 glutaredoxin 2; Provisional	Back alignment and domain information

>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene	Back alignment and domain information

>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>TIGR02182 GRXB Glutaredoxin, GrxB family	Back alignment and domain information

>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione	Back alignment and domain information

>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells	Back alignment and domain information

>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B	Back alignment and domain information

>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor	Back alignment and domain information

>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha	Back alignment and domain information

>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B	Back alignment and domain information

>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins	Back alignment and domain information

>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A	Back alignment and domain information

>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown]	Back alignment and domain information

>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait	Back alignment and domain information

>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins	Back alignment and domain information

>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms]	Back alignment and domain information

>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E	Back alignment and domain information

>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only]	Back alignment and domain information

>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		154
1gwc_A		230	The Structure Of A Tau Class Glutathione S-Transfer		7e-04

>pdb|1GWC|A Chain A, The Structure Of A Tau Class Glutathione S-Transferase From Wheat, Active In Herbicide Detoxification Length = 230

Back alignment and structure

Iteration: 1

Score = 39.7 bits (91), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 41/140 (29%), Positives = 64/140 (45%), Gaps = 17/140 (12%) Query: 1 SLDLIKYVDSNF--EGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSF--------KGDP 50 S+ +++Y+D F GPSLLP DP +R A +Y D + + + K + Sbjct: 69 SMIILQYIDEVFASTGPSLLPADPYERAIARFWVAYVDDKLVAPWRQWLRGKTEEEKSEG 128 Query: 51 AKEAGPCFDYLEKALHKFDD--GPFLLGQLSLVDIAYIPFVERAQIFLSEVIKYDI---T 105 K+A LE AL + G F + LVD+A + ++ +E + D Sbjct: 129 KKQAFAAVGVLEGALRECSKGGGFFGGDGVGLVDVALGGVLSWMKV--TEALSGDKIFDA 186 Query: 106 AGRPKLAAWIEELNQVDAYK 125 A P LAAW+E ++DA K Sbjct: 187 AKTPLLAAWVERFIELDAAK 206

PyMOL of 1gwc

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		154
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	2e-25
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	4e-25
3rbt_A		246	Glutathione transferase O1; glutathione S-transfer	3e-24
3vln_A		241	GSTO-1, glutathione S-transferase omega-1; GST fol	7e-23
3q18_A		239	GSTO-2, glutathione S-transferase omega-2; glutath	6e-22
1gwc_A		230	Glutathione S-transferase TSI-1; herbicide detoxif	7e-21
2r4v_A		247	XAP121, chloride intracellular channel protein 2;	1e-18
3fy7_A		250	Chloride intracellular channel protein 3; GST, glu	8e-18
1k0m_A		241	CLIC1, NCC27, chloride intracellular channel prote	2e-17
2ahe_A		267	Chloride intracellular channel protein 4; glutathi	3e-17
1yy7_A		213	SSPA, stringent starvation protein A; GST fold, tr	7e-17
2vo4_A		219	2,4-D inducible glutathione S-transferase; herbici	1e-16
3lxz_A		229	Glutathione S-transferase family protein; structur	1e-16
3lyp_A		215	Stringent starvation protein A; structural genomic	7e-16
2yv7_A		260	CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c	2e-15
4dej_A		231	Glutathione S-transferase related protein; transfe	7e-15
3lyk_A		216	Stringent starvation protein A homolog; structural	2e-14
2cz2_A		223	Maleylacetoacetate isomerase; structural genomics,	4e-14
3r2q_A		202	Uncharacterized GST-like protein YIBF; transferase	4e-14
1oyj_A		231	Glutathione S-transferase; herbicide detoxificatio	5e-14
3niv_A		222	Glutathione S-transferase; structural genomics, PS	2e-13
2v6k_A		214	Maleylpyruvate isomerase; glutathione-S-transferas	6e-13
3tou_A		226	Glutathione S-transferase protein; GSH binding sit	2e-12
2yv9_A		291	Chloride intracellular channel EXC-4; chloride ION	5e-12
3m0f_A		213	Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu	8e-12
3cbu_A		214	Probable GST-related protein; thioredoxin fold, GS	1e-11
3ubk_A		242	Glutathione transferase; GSH binding; 1.95A {Lepto	2e-11
3qav_A		243	RHO-class glutathione S-transferase; cytosol; 2.10	1e-10
1e6b_A		221	Glutathione S-transferase; 1.65A {Arabidopsis thal	7e-10
3bby_A		215	Uncharacterized GST-like protein YFCF; NP_416804.1	8e-10
3ibh_A		233	GST-II, saccharomyces cerevisiae GTT2; glutathione	6e-09
3n5o_A		235	Glutathione transferase; seattle structural genomi	1e-08
1gnw_A		211	Glutathione S-transferase; herbicide detoxificatio	2e-08
1ljr_A		244	HGST T2-2, glutathione S-transferase; HET: GSH; 3.	6e-08
1aw9_A		216	Glutathione S-transferase III; herbicide detoxific	1e-07
3ay8_A		216	Glutathione S-transferase; GST fold, GST binding,	1e-06
2c3n_A		247	Glutathione S-transferase theta 1; glutathione tra	2e-06
2imi_A		221	Epsilon-class glutathione S-transferase; HET: GSH;	2e-06
3ein_A		209	GST class-theta, glutathione S-transferase 1-1; de	3e-06
3lsz_A		225	Glutathione S-transferase; xenobiotic, biodegradat	4e-06
1axd_A		209	Glutathione S-transferase I; transferase, herbicid	5e-06
1r5a_A		218	Glutathione transferase; glutathione S-transferase	2e-05
2ycd_A		230	Glutathione S-transferase; SOIL bacteria, herbicid	3e-05
1pn9_A		209	GST class-delta, glutathione S-transferase 1-6; pr	4e-05
2uz8_A		174	Eukaryotic translation elongation factor 1 epsilon	2e-04
1n2a_A		201	Glutathione S-transferase; HET: GTS; 1.90A {Escher	8e-04

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471	Back alignment and structure

 Score = 99.4 bits (248), Expect = 2e-25
 Identities = 29/158 (18%), Positives = 58/158 (36%), Gaps = 8/158 (5%)

Query: 1   SLDLIKYVD-SNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFK----GDPAKEAG 55
           S+ + +Y+D S     +L+     +R   E   +    F    +G  +    G+  K   
Sbjct: 92  SMLIAQYLDNSGAPAGALMGSSAAQRHQIEFFLAQVGDFIGAAHGLLRDPLSGEKRKAMD 151

Query: 56  PCFDYLEKAL-HKFDDGPFLLG-QLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAA 113
               Y++  L      GP+    + ++ D+A +PF+ R +  L     YD+    P++ A
Sbjct: 152 DNAAYVDGLLAANQTTGPYYCDGEFTMADVALVPFLVRLKPALMYYAGYDVFCKAPRMKA 211

Query: 114 WIEELNQVDAYKQTKLKDPKGLVELYKIRYMVPYAEHF 151
                 Q  + ++T        +E Y+           
Sbjct: 212 LWAAAAQRASVRET-SPTAAQCIENYRHLVPESAPMMG 248

PyMOL of 4ags

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471	Back alignment and structure

>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246	Back alignment and structure

>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241	Back alignment and structure

>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239	Back alignment and structure

>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230	Back alignment and structure

>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247	Back alignment and structure

>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250	Back alignment and structure

>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241	Back alignment and structure

>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267	Back alignment and structure

>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213	Back alignment and structure

>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219	Back alignment and structure

>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229	Back alignment and structure

>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215	Back alignment and structure

>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260	Back alignment and structure

>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231	Back alignment and structure

>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216	Back alignment and structure

>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223	Back alignment and structure

>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202	Back alignment and structure

>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231	Back alignment and structure

>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222	Back alignment and structure

>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214	Back alignment and structure

>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226	Back alignment and structure

>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291	Back alignment and structure

>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213	Back alignment and structure

>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214	Back alignment and structure

>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242	Back alignment and structure

>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243	Back alignment and structure

>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221	Back alignment and structure

>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215	Back alignment and structure

>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233	Back alignment and structure

>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235	Back alignment and structure

>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211	Back alignment and structure

>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244	Back alignment and structure

>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216	Back alignment and structure

>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216	Back alignment and structure

>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247	Back alignment and structure

>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221	Back alignment and structure

>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209	Back alignment and structure

>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225	Back alignment and structure

>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209	Back alignment and structure

>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218	Back alignment and structure

>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230	Back alignment and structure

>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209	Back alignment and structure

>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174	Back alignment and structure

>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		154
4g10_A		265	Glutathione S-transferase homolog; thioredoxin fol	99.89
3q18_A		239	GSTO-2, glutathione S-transferase omega-2; glutath	99.89
3lxz_A		229	Glutathione S-transferase family protein; structur	99.89
3vk9_A		216	Glutathione S-transferase delta; glutathione bindi	99.88
3vln_A		241	GSTO-1, glutathione S-transferase omega-1; GST fol	99.88
4glt_A		225	Glutathione S-transferase-like protein; structural	99.88
3rbt_A		246	Glutathione transferase O1; glutathione S-transfer	99.88
2vo4_A		219	2,4-D inducible glutathione S-transferase; herbici	99.87
3lyk_A		216	Stringent starvation protein A homolog; structural	99.87
3ubk_A		242	Glutathione transferase; GSH binding; 1.95A {Lepto	99.87
4hi7_A		228	GI20122; GST, glutathione S-transferase, enzyme fu	99.87
4hoj_A		210	REGF protein; GST, glutathione S-transferase, enzy	99.87
4gci_A		211	Glutathione S-transferase; GST, enzyme function in	99.86
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	99.86
4dej_A		231	Glutathione S-transferase related protein; transfe	99.86
1oyj_A		231	Glutathione S-transferase; herbicide detoxificatio	99.86
3ay8_A		216	Glutathione S-transferase; GST fold, GST binding,	99.86
3lyp_A		215	Stringent starvation protein A; structural genomic	99.85
1gwc_A		230	Glutathione S-transferase TSI-1; herbicide detoxif	99.85
4gf0_A		215	Glutathione S-transferase; GST, enzyme function in	99.85
2imi_A		221	Epsilon-class glutathione S-transferase; HET: GSH;	99.85
3ibh_A		233	GST-II, saccharomyces cerevisiae GTT2; glutathione	99.85
1v2a_A		210	Glutathione transferase GST1-6; glutathione S-tran	99.85
3ein_A		209	GST class-theta, glutathione S-transferase 1-1; de	99.84
2x64_A		207	Glutathione-S-transferase; detoxification enzyme;	99.84
3r2q_A		202	Uncharacterized GST-like protein YIBF; transferase	99.84
3tou_A		226	Glutathione S-transferase protein; GSH binding sit	99.84
1n2a_A		201	Glutathione S-transferase; HET: GTS; 1.90A {Escher	99.84
3niv_A		222	Glutathione S-transferase; structural genomics, PS	99.84
1r5a_A		218	Glutathione transferase; glutathione S-transferase	99.84
3f6d_A		219	Adgstd4-4, glutathione transferase GST1-4; HET: GT	99.84
3qav_A		243	RHO-class glutathione S-transferase; cytosol; 2.10	99.83
1pn9_A		209	GST class-delta, glutathione S-transferase 1-6; pr	99.83
3n5o_A		235	Glutathione transferase; seattle structural genomi	99.83
3cbu_A		214	Probable GST-related protein; thioredoxin fold, GS	99.83
1yy7_A		213	SSPA, stringent starvation protein A; GST fold, tr	99.83
3uar_A		227	Glutathione S-transferase; GSH binding site; HET:	99.83
2pvq_A		201	Glutathione S-transferase; xenobiotics detoxificat	99.83
2dsa_A		203	Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu	99.83
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	99.83
1f2e_A		201	Glutathione S-transferase; GST complexed with glut	99.83
2uz8_A		174	Eukaryotic translation elongation factor 1 epsilon	99.82
1pmt_A		203	PMGST, GST B1-1, glutathione transferase; glutathi	99.82
1e6b_A		221	Glutathione S-transferase; 1.65A {Arabidopsis thal	99.82
2cz2_A		223	Maleylacetoacetate isomerase; structural genomics,	99.82
4iel_A		229	Glutathione S-transferase, N-terminal domain PROT;	99.82
1nhy_A		219	EF-1-gamma 1, elongation factor 1-gamma 1; protein	99.82
4hz4_A		217	Glutathione-S-transferase; enzyme function initiat	99.82
2v6k_A		214	Maleylpyruvate isomerase; glutathione-S-transferas	99.81
1k0m_A		241	CLIC1, NCC27, chloride intracellular channel prote	99.81
3gtu_B		224	Glutathione S-transferase; conjugation, detoxifica	99.81
2cvd_A		198	Glutathione-requiring prostaglandin D synthase; gl	99.81
3lsz_A		225	Glutathione S-transferase; xenobiotic, biodegradat	99.81
3ik7_A		222	Glutathione S-transferase A4; human GST A4-4, enzy	99.81
2gsq_A		202	Squid GST, glutathione S-transferase; squid digest	99.81
2fhe_A		216	GST, glutathione S-transferase; transferase-substr	99.81
1gsu_A		219	GST, CGSTM1-1, class-MU glutathione S-transferase;	99.81
3m0f_A		213	Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu	99.81
2r4v_A		247	XAP121, chloride intracellular channel protein 2;	99.81
1gnw_A		211	Glutathione S-transferase; herbicide detoxificatio	99.81
1vf1_A		229	Glutathione S-transferase 3; detoxification; HET:	99.81
4ikh_A		244	Glutathione S-transferase; enzyme function initiat	99.8
3iso_A		218	Putative glutathione transferase; GST; HET: GSH; 1	99.8
1tw9_A		206	Glutathione S-transferase 2; 1.71A {Heligmosomoide	99.8
4exj_A		238	Uncharacterized protein; transferase-like protein,	99.8
1yq1_A		208	Glutathione S-transferase; nematoda, structural ge	99.8
2a2r_A		210	Glutathione S-transferase P; detoxification, nitri	99.8
1dug_A		234	Chimera of glutathione S-transferase-synthetic lin	99.8
3m3m_A		210	Glutathione S-transferase; PSI-II, structural geno	99.8
3gx0_A		215	GST-like protein YFCG; transferase, glutathione, g	99.8
2c4j_A		218	Glutathione S-transferase MU 2; glutathione transf	99.79
1k3y_A		221	GSTA1-1, glutathione S-transferase A1; S-hexyl glu	99.79
2ahe_A		267	Chloride intracellular channel protein 4; glutathi	99.79
2on7_A		206	Nagst-1, Na glutathione S-transferase 1; hookworm;	99.79
1tu7_A		208	Glutathione S-transferase 2; HET: GSH; 1.50A {Onch	99.79
1b48_A		221	GST, mgsta4-4, protein (glutathione S-transferase)	99.79
1axd_A		209	Glutathione S-transferase I; transferase, herbicid	99.79
1oe8_A		211	Glutathione S-transferase; schistosomiasis, detoxi	99.79
1b8x_A		280	Protein (AML-1B); nuclear matrix targeting signal	99.79
1zl9_A		207	GST class-sigma, glutathione S-transferase 5; glut	99.79
1ljr_A		244	HGST T2-2, glutathione S-transferase; HET: GSH; 3.	99.78
4id0_A		214	Glutathione S-transferase-like protein YIBF; GST,	99.78
4fqu_A		313	Putative glutathione transferase; glutathionyl-hyd	99.78
2on5_A		206	Nagst-2, Na glutathione S-transferase 2; hookworm;	99.78
2wb9_A		211	Glutathione transferase sigma class; thioredoxin f	99.78
3fy7_A		250	Chloride intracellular channel protein 3; GST, glu	99.78
4hz2_A		230	Glutathione S-transferase domain; glutathione,enzy	99.78
1m0u_A		249	GST2 gene product; flight muscle protein, sigma, t	99.77
3m1g_A		362	Putative glutathione S-transferase; ECM4-like subf	99.77
2hnl_A		225	Glutathione S-transferase 1; prostaglandin synthas	99.77
3bby_A		215	Uncharacterized GST-like protein YFCF; NP_416804.1	99.77
2hra_A		209	Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l	99.77
1okt_A		211	Glutathione S-transferase; GST; 1.9A {Plasmodium f	99.76
4ecj_A		244	Glutathione S-transferase; transferase-like protei	99.76
3m8n_A		225	Possible glutathione S-transferase; PSI-II, struct	99.76
2yv7_A		260	CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c	99.76
4g0i_A		328	Protein YQJG; glutathionyl-hydroquinone reductase,	99.75
2yv9_A		291	Chloride intracellular channel EXC-4; chloride ION	99.75
1aw9_A		216	Glutathione S-transferase III; herbicide detoxific	99.75
3h1n_A		252	Probable glutathione S-transferase; APC84167, bord	99.75
3ppu_A		352	Glutathione-S-transferase; GST fold; HET: GSH; 2.3	99.74
3c8e_A		288	YGHU, glutathione S-transferase homologue; glutath	99.74
1k0d_A		260	URE2 protein; nitrate assimilation, structural gen	99.74
1bg5_A		254	MAB, fusion protein of alpha-Na,K-ATPase with glut	99.74
2ws2_A		204	NU-class GST, glutathione S-transferase; parasite,	99.74
2c3n_A		247	Glutathione S-transferase theta 1; glutathione tra	99.74
2ycd_A		230	Glutathione S-transferase; SOIL bacteria, herbicid	99.73
3ir4_A		218	Glutaredoxin 2; glutathione, IDP00895, structural	99.64
2fno_A		248	AGR_PAT_752P; thioredoxin fold, GST C-terminal dom	99.61
3ic8_A		310	Uncharacterized GST-like proteinprotein; glutathio	99.61
4akg_A		2695	Glutathione S-transferase class-MU 26 kDa isozyme	99.58
1z9h_A		290	Membrane-associated prostaglandin E synthase-2; me	99.42
4f03_A		253	Glutathione transferase; GST fold; 1.80A {Phaneroc	99.39
2hqt_A		124	GU4 nucleic-binding protein 1; GST-fold, biosynthe	99.13
2hsn_A		160	Methionyl-tRNA synthetase, cytoplasmic; protein co	98.95

>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis}	Back alignment and structure

Probab=99.89  E-value=4.7e-23  Score=151.15  Aligned_cols=142  Identities=16%  Similarity=0.303  Sum_probs=104.5

Q ss_pred             ChHHHHHHHhcCCCCCCCCCCHHHHHHHHHHhhhhcccchhhhccc-c---C---CchhhhhhHHHHHHHHhhcC-CCCC
Q 036444            1 SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSF-K---G---DPAKEAGPCFDYLEKALHKF-DDGP   72 (154)
Q Consensus         1 S~aI~~yL~~~~~~~~L~p~~~~~~a~~~~~~~~~~~~~~~~~~~~-~---~---~~~~~~~~~l~~le~~L~~~-~~~~   72 (154)
                      |.||++||+++||+++|+|.++.++++++.|+.+.+.+....+... .   +   +..+.+...+..+++.|.+. ++++
T Consensus        71 S~aI~~YL~~~~p~~~L~P~d~~~ra~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~L~~~l~~~~  150 (265)
T 4g10_A           71 SMVILRYLEQRYPEPAVAHPDPFCHAVEGMLAELAGPFSGAGYRMILNREIGKREEMRAAVDAEFGKVDAFLKRYATGSD  150 (265)
T ss_dssp             HHHHHHHHHHHSCSSCCSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHCCCGGGHHHHHHHHHHHHHHHHHHHHHHCCSSS
T ss_pred             cHHHHHHHhhcCcchhcccccHHHHHHHHHHHHHHHhhhhHHHHHHHhcccchhHHHHHHHHHhhhhhHHHHHHHhccCc
Confidence            6899999999999889999999999999999998877544333322 1   1   12233344444444444321 2789


Q ss_pred             eeecC-CcHHHHHHhhHHHHHHHHhccccccccccCCchHHHHHHHHhcchhhhhcccCChhhHHHHHHHHhhcc
Q 036444           73 FLLGQ-LSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELYKIRYMVP  146 (154)
Q Consensus        73 fl~G~-~t~ADi~~~~~l~~~~~~~~~~~~~~~~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  146 (154)
                      |++|+ +|+|||+++|++.++..+. ...+.++..++|+|.+|+++|.+||+||++.+   +.+.+.++.+..+.
T Consensus       151 ~l~Gd~~t~ADi~l~p~l~~l~~l~-~~~~~~~~~~~P~l~~w~~r~~~rPa~q~t~~---ee~~~~~~~~~~g~  221 (265)
T 4g10_A          151 FLFDDRFGWAEVAFTPMFKRLWFLD-YYEDYEVPANFDRVLRWRAACTAHPAAQYRSK---EELLKLYYDYTQGG  221 (265)
T ss_dssp             SSSTTCCCHHHHHHHHHHHHTHHHH-HHSCCCCCTTCHHHHHHHHHHHHSGGGCSSCH---HHHHHHTHHHHTTC
T ss_pred             cccCCCCeeeHHHHHHHHHHHHHHh-hhcCCCccccCHHHHHHHHHHHcCHHHHhhCc---HHHHHHHHHHHcCC
Confidence            99999 9999999999998876532 23355555689999999999999999999876   45777777765543

PyMOL of 4g10

>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A*	Back alignment and structure

>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A*	Back alignment and structure

>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori}	Back alignment and structure

>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A*	Back alignment and structure

>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus}	Back alignment and structure

>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori}	Back alignment and structure

>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A*	Back alignment and structure

>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae}	Back alignment and structure

>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A*	Back alignment and structure

>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis}	Back alignment and structure

>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae}	Back alignment and structure

>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A*	Back alignment and structure

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum}	Back alignment and structure

>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis}	Back alignment and structure

>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori}	Back alignment and structure

>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A	Back alignment and structure

>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter}	Back alignment and structure

>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A*	Back alignment and structure

>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A*	Back alignment and structure

>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A*	Back alignment and structure

>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa}	Back alignment and structure

>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli}	Back alignment and structure

>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A*	Back alignment and structure

>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A*	Back alignment and structure

>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp}	Back alignment and structure

>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A*	Back alignment and structure

>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A*	Back alignment and structure

>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A*	Back alignment and structure

>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha}	Back alignment and structure

>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis}	Back alignment and structure

>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A*	Back alignment and structure

>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A*	Back alignment and structure

>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A*	Back alignment and structure

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum}	Back alignment and structure

>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens}	Back alignment and structure

>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A*	Back alignment and structure

>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A*	Back alignment and structure

>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria}	Back alignment and structure

>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae}	Back alignment and structure

>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A*	Back alignment and structure

>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A	Back alignment and structure

>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1*	Back alignment and structure

>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides}	Back alignment and structure

>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A*	Back alignment and structure

>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A*	Back alignment and structure

>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A*	Back alignment and structure

>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A*	Back alignment and structure

>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A*	Back alignment and structure

>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A*	Back alignment and structure

>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A*	Back alignment and structure

>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A	Back alignment and structure

>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens}	Back alignment and structure

>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis}	Back alignment and structure

>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239}	Back alignment and structure

>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans}	Back alignment and structure

>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ...	Back alignment and structure

>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A*	Back alignment and structure

>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens}	Back alignment and structure

>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli}	Back alignment and structure

>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ...	Back alignment and structure

>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ...	Back alignment and structure

>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A	Back alignment and structure

>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus}	Back alignment and structure

>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A*	Back alignment and structure

>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A	Back alignment and structure

>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A*	Back alignment and structure

>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A*	Back alignment and structure

>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans}	Back alignment and structure

>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A*	Back alignment and structure

>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A*	Back alignment and structure

>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum}	Back alignment and structure

>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus}	Back alignment and structure

>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A*	Back alignment and structure

>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A	Back alignment and structure

>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus}	Back alignment and structure

>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum}	Back alignment and structure

>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus}	Back alignment and structure

>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli}	Back alignment and structure

>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A	Back alignment and structure

>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A*	Back alignment and structure

>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A*	Back alignment and structure

>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris}	Back alignment and structure

>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster}	Back alignment and structure

>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A*	Back alignment and structure

>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50}	Back alignment and structure

>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium}	Back alignment and structure

>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli}	Back alignment and structure

>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A	Back alignment and structure

>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus}	Back alignment and structure

>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A	Back alignment and structure

>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A	Back alignment and structure

>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A	Back alignment and structure

>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV}	Back alignment and structure

>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A	Back alignment and structure

>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A*	Back alignment and structure

>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A*	Back alignment and structure

>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B	Back alignment and structure

>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		154
d1k0ma1		149	a.45.1.1 (A:92-240) Chloride intracellular channel	2e-11
d1oyja1		145	a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat	2e-10
d1gwca1		138	a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch	1e-08
d1eema1		139	a.45.1.1 (A:103-241) Class omega GST {Human (Homo	2e-08
d1k0da1		151	a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni	1e-05
d1e6ba1		133	a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres	2e-05
d1pmta1		121	a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi	9e-05
d1aw9a1		135	a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays	1e-04
d1f2ea1		121	a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p	2e-04
d1n2aa1		121	a.45.1.1 (A:81-201) Class beta GST {Escherichia co	3e-04
d1fw1a1		125	a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa	7e-04
d1gnwa1		126	a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress	7e-04
d1jlwa1		127	a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano	0.002
d1r5aa1		129	a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano	0.002

>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149	Back information, alignment and structure


class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Chloride intracellular channel 1 (clic1)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.3 bits (135), Expect = 2e-11
 Identities = 17/144 (11%), Positives = 37/144 (25%), Gaps = 14/144 (9%)

Query: 1   SLDLIKYVDSNFEGPSLLPDDPEKRKFAEELFSYSDTFNITVYGSFKGDPAKEAGPCFDY 60
           S      + + F       +        + L       +  +                D 
Sbjct: 12  SNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEG--------VDE 63

Query: 61  LEKALHKFDDGPFLLG-QLSLVDIAYIPFVERAQIFLSEVIKYDITAGRPKLAAWIEELN 119
                       FL G +L+L D   +P +   Q+   +   + I      +  ++    
Sbjct: 64  TSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAY 123

Query: 120 QVDAYKQTKLKDPKGLVELYKIRY 143
             + +  T   D     E  ++ Y
Sbjct: 124 AREEFASTCPDD-----EEIELAY 142

PyMOL of d1k0ma1

>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145	Back information, alignment and structure

>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138	Back information, alignment and structure

>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139	Back information, alignment and structure

>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151	Back information, alignment and structure

>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133	Back information, alignment and structure

>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121	Back information, alignment and structure

>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135	Back information, alignment and structure

>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121	Back information, alignment and structure

>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121	Back information, alignment and structure

>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125	Back information, alignment and structure

>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126	Back information, alignment and structure

>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127	Back information, alignment and structure

>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		154
d1gwca1		138	Class tau GST {Aegilops tauschii, also known as Tr	99.88
d1eema1		139	Class omega GST {Human (Homo sapiens) [TaxId: 9606	99.87
d1n2aa1		121	Class beta GST {Escherichia coli [TaxId: 562]}	99.82
d1oyja1		145	Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}	99.81
d1fw1a1		125	Class zeta GST {Human (Homo sapiens) [TaxId: 9606]	99.81
d1e6ba1		133	Class zeta GST {Mouse-ear cress (Arabidopsis thali	99.81
d1v2aa1		125	Class delta GST {Mosquito (Anopheles dirus b), iso	99.79
d1pmta1		121	Class beta GST {Proteus mirabilis [TaxId: 584]}	99.79
d1f2ea1		121	Class beta GST {Sphingomonas paucimobilis [TaxId:	99.78
d1axda1		129	Class phi GST {Maize (Zea mays), type I [TaxId: 45	99.75
d1jlva1		123	Class delta GST {Mosquito (Anopheles dirus b), iso	99.75
d1ljra1		165	Class theta GST {Human (Homo sapiens) [TaxId: 9606	99.75
d1r5aa1		129	Class delta GST {Mosquito (Anopheles dirus b), iso	99.75
d1b48a1		143	Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax	99.74
d1k3ya1		142	Class alpha GST {Human (Homo sapiens), (a1-1) [Tax	99.74
d1jlwa1		127	Class delta GST {Mosquito (Anopheles dirus b), iso	99.74
d2cvda1		124	Class sigma GST {Human (Homo sapiens) [TaxId: 9606	99.74
d1k0da1		151	Yeast prion protein ure2p, nitrogen regulation fra	99.73
d1aw9a1		135	Class phi GST {Maize (Zea mays), type III [TaxId:	99.73
d1nhya1		144	GST-like domain of elongation factor 1-gamma {Bake	99.73
d2gsqa1		127	Class sigma GST {Squid (Ommastrephes sloani pacifi	99.73
d1gula1		140	Class alpha GST {Human (Homo sapiens), (a1-1) [Tax	99.71
d3gtub1		140	Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	99.71
d1m0ua1		127	Class sigma GST {Fruit fly (Drosophila melanogaste	99.7
d2gsta1		133	Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011	99.7
d2a2ra1		132	Class pi GST {Human (Homo sapiens) [TaxId: 9606]}	99.7
d2c4ja1		133	Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	99.69
d1gsua1		133	Class mu GST {Chicken (Gallus gallus) [TaxId: 9031	99.69
d1tw9a1		129	Class sigma GST {Heligmosomoides polygyrus [TaxId:	99.68
d1gnwa1		126	Class phi GST {Mouse-ear cress (Arabidopsis thalia	99.66
d1k0ma1		149	Chloride intracellular channel 1 (clic1) {Human (H	99.66
d1duga1		140	Class alpha GST {Schistosoma japonicum [TaxId: 618	99.64
d1okta1		126	Pf GST {Malarial parasite (Plasmodium falciparum)	99.62
d2fhea1		136	Class alpha GST {Fasciola hepatica [TaxId: 6192]}	99.6
d1oe8a1		123	Class alpha GST {Blood fluke (Schistosoma haematob	99.55
d1tu7a1		131	Class pi GST {Onchocerca volvulus [TaxId: 6282]}	99.54
d2hrkb1		118	GU4 nucleic-binding protein 1, Arc1p {Baker's yeas	99.27
d1z9ha1		161	Microsomal prostaglandin E synthase-2 {Crab-eating	98.93
d1g7oa1		140	Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	97.26
d2fnoa1		149	Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac	96.44

>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}	Back information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class tau GST
species: Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]

Probab=99.88  E-value=1.4e-22  Score=132.97  Aligned_cols=123  Identities=28%  Similarity=0.346  Sum_probs=96.7

Q ss_pred             CCCCCHHHHHHHHHHhhhhcc-cchhhhcccc--C-----C----chhhhhhHHHHHHHHhhcCCCCCeeecC-CcHHHH
Q 036444           17 LLPDDPEKRKFAEELFSYSDT-FNITVYGSFK--G-----D----PAKEAGPCFDYLEKALHKFDDGPFLLGQ-LSLVDI   83 (154)
Q Consensus        17 L~p~~~~~~a~~~~~~~~~~~-~~~~~~~~~~--~-----~----~~~~~~~~l~~le~~L~~~~~~~fl~G~-~t~ADi   83 (154)
                      |+|+||.+|++++.|+.++++ +.+.+.....  .     +    ..+.+...++.|++.+.   +++|++|+ +|+||+
T Consensus         1 LlP~Dp~~RA~~r~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~l~---~~~~l~Gd~~slaDi   77 (138)
T d1gwca1           1 LLPADPYERAIARFWVAYVDDKLVAPWRQWLRGKTEEEKSEGKKQAFAAVGVLEGALRECSK---GGGFFGGDGVGLVDV   77 (138)
T ss_dssp             SSCSSHHHHHHHHHHHHHHHHHTHHHHHHHHHCSSHHHHHHHHHHHHHHHHHHHHHHHHHCT---TSCBTTBTSCCHHHH
T ss_pred             CCCcCHHHHHHHHHHHHHHHhHhhHHHHHHHHhcchhhHHHHHHHHHHHHHHHHHHHHHHhC---CCeeeccCCCcchhh
Confidence            789999999999999999987 5444443321  1     1    23456666667777776   78999999 999999


Q ss_pred             HHhhHHHHHHHHhcccccccc--ccCCchHHHHHHHHhcchhhhhcccCChhhHHHHHHHHhh
Q 036444           84 AYIPFVERAQIFLSEVIKYDI--TAGRPKLAAWIEELNQVDAYKQTKLKDPKGLVELYKIRYM  144 (154)
Q Consensus        84 ~~~~~l~~~~~~~~~~~~~~~--~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  144 (154)
                      +++|++.++..+. ...+.+.  .+++|+|.+|+++|.++|+|+++++ +.+.+.+++|++.+
T Consensus        78 ~l~~~~~~~~~~~-~~~~~~~~~~~~~P~l~~w~~~~~~rPav~~~~p-~~e~~~~~~k~r~a  138 (138)
T d1gwca1          78 ALGGVLSWMKVTE-ALSGDKIFDAAKTPLLAAWVERFIELDAAKAALP-DVGRLLEFAKAREA  138 (138)
T ss_dssp             HHHTTHHHHHHHH-HHHSCCTTCTTTCHHHHHHHHHHHHSHHHHHHSC-CHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHH-HHcCcchhhHhhHHHHHHHHHHHHcCHHHHHHCC-CHHHHHHHHHHhcC
Confidence            9999999987642 2233332  3589999999999999999999999 99999999998764

PyMOL of d1gwca1

>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}	Back information, alignment and structure

>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]}	Back information, alignment and structure

>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]}	Back information, alignment and structure

>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}	Back information, alignment and structure

>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]}	Back information, alignment and structure

>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}	Back information, alignment and structure

>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]}	Back information, alignment and structure

>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}	Back information, alignment and structure

>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]}	Back information, alignment and structure

>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}	Back information, alignment and structure

>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}	Back information, alignment and structure

>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}	Back information, alignment and structure

>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}	Back information, alignment and structure

>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}	Back information, alignment and structure

>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]}	Back information, alignment and structure

>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}	Back information, alignment and structure

>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]}	Back information, alignment and structure

>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}	Back information, alignment and structure

>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure