Citrus Sinensis ID: 036452


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MAFPNELAAGREELSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYSNNSVKSTIDRYKKATADTSNTGSICEANAQFYQQEAAKLRIQISNMQNSNRNMLGESLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNSNQLLRAKIAENERGQQNMNLMQGGSSYEIIQSQPFDSRSYFQVNALQPTNHYPRQDQMALQL
ccccccHccccccccccccccccccHHHHccccccccccccccccccHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc
*************************EIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYSNNSVKSTIDRYK**********SICEANAQFYQQEAAKLRIQISNMQNSNRNMLGESLSGLNFKELKNMETRLEKGISRIRSKKNELLFAEIEYMQKREVDLHNSNQLLRAKI******************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFPNELAAGREELSPKRKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYSNNSVKSTIDRYKKATADTSNTGSICEANxxxxxxxxxxxxxxxxxxxxxNRNMLGESLSGLNFKExxxxxxxxxxxxxxxxxxxxxLLFAEIEYMQKREVDLHNSNQLLRAKIAENERGQQNMNLMQGGSSYEIIQSQPFDSRSYFQVNALQPTNHYPRQDQMALQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Floral homeotic protein AGAMOUS Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms an heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development.confidentP17839
MADS-box transcription factor 58 Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3.probableQ2V0P1
Floral homeotic protein AGAMOUS Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers.probableQ40872

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K6O, chain B
Confidence level:very confident
Coverage over the Query: 16-95
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 138-186
View the alignment between query and template
View the model in PyMOL