Citrus Sinensis ID: 036473


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRLST
ccEEcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccccccccccccccccEEccEEcccccEEEEEEEEEcccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEcccccEEEEEEEcccc
HHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHHHHccccccccEEccccEEEccEEEccccEEEEcHHHHHcccccccccccccHHHHEcccccEcccccEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEccccEEEEccccccc
dmlagamdtspTVVEWALSELIKHPAVMKKLQRELENIVGLKRMveesdlenlEYLDMVVKETLrlhpvaplmaphesmedctvngfhipkksRVIVNAWAigrdpkawndpekffperfvgssvdvrgrdfqllpfgsgrracpgmQLALTVVKQVTAQLVHCfdwelpegmlpteldmteefGLVTYRAKHLlavpsyrlst
dmlagamdtsptVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKhllavpsyrlst
DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRLST
***********TVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPS*****
DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRL**
**********PTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRLST
DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYR***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMLAGAMDTSPTVVEWALSELIKHPAVxxxxxxxxxxxxxxxxxxxxxDLENLEYLDMVVKETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRLST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
P24465502 Cytochrome P450 71A1 OS=P N/A no 0.995 0.404 0.517 6e-62
Q42600520 Cytochrome P450 84A1 OS=A yes no 0.985 0.386 0.522 3e-61
O64635511 Cytochrome P450 76C4 OS=A no no 0.970 0.387 0.484 2e-58
O48956512 Cytochrome P450 98A1 OS=S N/A no 0.990 0.394 0.485 3e-57
O64636512 Cytochrome P450 76C1 OS=A no no 0.970 0.386 0.494 5e-57
O48922509 Cytochrome P450 98A2 OS=G no no 1.0 0.400 0.504 8e-57
O64637512 Cytochrome P450 76C2 OS=A no no 0.970 0.386 0.489 1e-56
O48923510 Cytochrome P450 71D10 OS= no no 0.990 0.396 0.485 2e-56
Q9LIP3500 Cytochrome P450 71B37 OS= no no 0.995 0.406 0.482 4e-56
O22203508 Cytochrome P450 98A3 OS=A no no 1.0 0.401 0.485 9e-56
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function desciption
 Score =  236 bits (603), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 105/203 (51%), Positives = 142/203 (69%)

Query: 1   DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV 60
           DM +G  DT+   +EWA++ELIKHP VM+K Q+E+  +VG K  VEE DL  L YL +++
Sbjct: 300 DMFSGGTDTTAVTLEWAMAELIKHPDVMEKAQQEVRRVVGKKAKVEEEDLHQLHYLKLII 359

Query: 61  KETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERF 120
           KETLRLHPVAPL+ P ES  D  + G+HIP K+RV +NAWAIGRDPK+W + E+F PERF
Sbjct: 360 KETLRLHPVAPLLVPRESTRDVVIRGYHIPAKTRVFINAWAIGRDPKSWENAEEFLPERF 419

Query: 121 VGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDM 180
           V +SVD +G+DFQL+PFG+GRR CPG+   ++ V+   A L++ F+WELP  +   +LDM
Sbjct: 420 VNNSVDFKGQDFQLIPFGAGRRGCPGIAFGISSVEISLANLLYWFNWELPGDLTKEDLDM 479

Query: 181 TEEFGLVTYRAKHLLAVPSYRLS 203
           +E  G+  +    L  V    LS
Sbjct: 480 SEAVGITVHMKFPLQLVAKRHLS 502




Involved in the metabolism of compounds associated with the development of flavor in the ripening fruit process, possibly by acting as trans-cinnamic acid 4-hydrolase.
Persea americana (taxid: 3435)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=2 SV=1 Back     alignment and function description
>sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 Back     alignment and function description
>sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 Back     alignment and function description
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function description
>sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 Back     alignment and function description
>sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 Back     alignment and function description
>sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description
>sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
224093832271 predicted protein [Populus trichocarpa] 0.995 0.749 0.763 2e-93
225438595 498 PREDICTED: cytochrome P450 71A1 [Vitis v 0.990 0.405 0.772 4e-93
224095628204 cytochrome P450 [Populus trichocarpa] gi 0.995 0.995 0.753 1e-91
224093826 493 cytochrome P450 [Populus trichocarpa] gi 0.995 0.411 0.748 1e-91
296082484 563 unnamed protein product [Vitis vinifera] 0.985 0.357 0.761 2e-90
296082482 608 unnamed protein product [Vitis vinifera] 0.990 0.332 0.747 2e-89
225438597 494 PREDICTED: cytochrome P450 71A1 [Vitis v 0.990 0.408 0.747 2e-88
224093838 497 cytochrome P450 [Populus trichocarpa] gi 0.990 0.406 0.732 8e-88
224093842 497 cytochrome P450 [Populus trichocarpa] gi 0.990 0.406 0.732 9e-88
255582520 505 flavonoid 3-hydroxylase, putative [Ricin 0.990 0.4 0.727 2e-87
>gi|224093832|ref|XP_002310011.1| predicted protein [Populus trichocarpa] gi|222852914|gb|EEE90461.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 182/203 (89%)

Query: 1   DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV 60
           DMLAG+MDTS TV++WA SELIK+P VMKK+Q+ELE +VG +RMVEESDLE+LEYLDMVV
Sbjct: 68  DMLAGSMDTSSTVIDWAFSELIKNPRVMKKVQKELEEVVGKQRMVEESDLESLEYLDMVV 127

Query: 61  KETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERF 120
           KET RLHPV PL+ PHE+MEDC VNGFHIPKKS VI+N WAIGRDPKAW D E F+PERF
Sbjct: 128 KETFRLHPVGPLLIPHEAMEDCIVNGFHIPKKSHVIINVWAIGRDPKAWTDAENFYPERF 187

Query: 121 VGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDM 180
           VGS +DVRGR+FQL+PFG+GRR+CPGMQL LTVV+ V AQLVHCFDWELP G+LP+E+DM
Sbjct: 188 VGSDIDVRGRNFQLIPFGAGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDM 247

Query: 181 TEEFGLVTYRAKHLLAVPSYRLS 203
           TEEFGLV  R+KHL+A+P+YRL+
Sbjct: 248 TEEFGLVICRSKHLVAIPTYRLN 270




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438595|ref|XP_002280620.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224095628|ref|XP_002334744.1| cytochrome P450 [Populus trichocarpa] gi|222874237|gb|EEF11368.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093826|ref|XP_002310008.1| cytochrome P450 [Populus trichocarpa] gi|222852911|gb|EEE90458.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296082484|emb|CBI21489.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082482|emb|CBI21487.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225438597|ref|XP_002276487.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224093838|ref|XP_002310014.1| cytochrome P450 [Populus trichocarpa] gi|222852917|gb|EEE90464.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093842|ref|XP_002310016.1| cytochrome P450 [Populus trichocarpa] gi|222852919|gb|EEE90466.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255582520|ref|XP_002532045.1| flavonoid 3-hydroxylase, putative [Ricinus communis] gi|223528288|gb|EEF30335.1| flavonoid 3-hydroxylase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
TAIR|locus:2122194520 FAH1 "ferulic acid 5-hydroxyla 0.985 0.386 0.522 1.2e-56
TAIR|locus:2043694511 CYP76C4 ""cytochrome P450, fam 0.970 0.387 0.484 3.4e-54
TAIR|locus:2043699512 CYP76C1 ""cytochrome P450, fam 0.970 0.386 0.494 4.9e-53
TAIR|locus:2043605512 CYP76C2 ""cytochrome P450, fam 0.970 0.386 0.489 1.3e-52
TAIR|locus:2058440508 CYP98A3 "cytochrome P450, fami 0.990 0.397 0.490 2.7e-52
TAIR|locus:2079316500 CYP71B37 ""cytochrome P450, fa 0.970 0.396 0.489 4.4e-52
TAIR|locus:2142878513 TT7 "TRANSPARENT TESTA 7" [Ara 0.995 0.395 0.497 7.2e-52
TAIR|locus:2043614515 CYP76C3 ""cytochrome P450, fam 0.965 0.382 0.484 2.4e-51
UNIPROTKB|Q8VWZ7493 CYP76B6 "Geraniol 8-hydroxylas 0.975 0.403 0.482 5.1e-51
TAIR|locus:2079306500 CYP71B35 ""cytochrome P450, fa 0.995 0.406 0.467 8.3e-51
TAIR|locus:2122194 FAH1 "ferulic acid 5-hydroxylase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 583 (210.3 bits), Expect = 1.2e-56, P = 1.2e-56
 Identities = 106/203 (52%), Positives = 147/203 (72%)

Query:     1 DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV 60
             D++ G  +T  + +EWAL+EL++ P  +K++Q+EL  +VGL R VEESD+E L YL   +
Sbjct:   315 DVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGLDRRVEESDIEKLTYLKCTL 374

Query:    61 KETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERF 120
             KETLR+HP  PL+  HE+ ED +++GF IPKKSRV++NA+AIGRDP +W DP+ F P RF
Sbjct:   375 KETLRMHPPIPLLL-HETAEDTSIDGFFIPKKSRVMINAFAIGRDPTSWTDPDTFRPSRF 433

Query:   121 VGSSV-DVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELD 179
             +   V D +G +F+ +PFGSGRR+CPGMQL L  +    A ++HCF W+LP+GM P+ELD
Sbjct:   434 LEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHILHCFTWKLPDGMKPSELD 493

Query:   180 MTEEFGLVTYRAKHLLAVPSYRL 202
             M + FGL   +A  L AVP+ RL
Sbjct:   494 MNDVFGLTAPKATRLFAVPTTRL 516




GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IDA
GO:0009699 "phenylpropanoid biosynthetic process" evidence=TAS
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0010224 "response to UV-B" evidence=IMP
GO:0009809 "lignin biosynthetic process" evidence=IMP;TAS
GO:0046424 "ferulate 5-hydroxylase activity" evidence=IMP
TAIR|locus:2043694 CYP76C4 ""cytochrome P450, family 76, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058440 CYP98A3 "cytochrome P450, family 98, subfamily A, polypeptide 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142878 TT7 "TRANSPARENT TESTA 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8VWZ7 CYP76B6 "Geraniol 8-hydroxylase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
TAIR|locus:2079306 CYP71B35 ""cytochrome P450, family 71, subfamily B, polypeptide 35"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.14.15.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
CYP736A3v2
cytochrome P450 (271 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0168001901
cytochrome P450 (125 aa)
       0.482
eugene3.01680053
cytochrome P450 (125 aa)
       0.467
CYP715A2-2
cytochrome P450 (359 aa)
       0.407

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-87
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-79
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-76
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 5e-68
pfam00067461 pfam00067, p450, Cytochrome P450 6e-64
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-58
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 6e-56
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 3e-51
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-43
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 7e-42
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-36
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 6e-36
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-34
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 6e-30
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 5e-27
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 9e-21
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 2e-20
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-19
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 6e-18
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 2e-15
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 5e-15
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 2e-14
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 5e-14
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 5e-11
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 1e-10
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 7e-10
PLN02648480 PLN02648, PLN02648, allene oxide synthase 8e-04
PRK00566 1156 PRK00566, PRK00566, DNA-directed RNA polymerase su 0.004
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
 Score =  265 bits (680), Expect = 2e-87
 Identities = 111/203 (54%), Positives = 146/203 (71%), Gaps = 2/203 (0%)

Query: 1   DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV 60
           D++ G  +T  + +EWA++EL+K P  +K++Q+EL ++VGL R VEESDLE L YL   +
Sbjct: 311 DVMFGGTETVASAIEWAMAELMKSPEDLKRVQQELADVVGLNRRVEESDLEKLTYLKCTL 370

Query: 61  KETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERF 120
           KETLRLHP  PL+  HE+ ED  V G+ IPK+SRV++NAWAIGRD  +W DP+ F P RF
Sbjct: 371 KETLRLHPPIPLLL-HETAEDAEVAGYFIPKRSRVMINAWAIGRDKNSWEDPDTFKPSRF 429

Query: 121 VGSSV-DVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELD 179
           +   V D +G  F+ +PFGSGRR+CPGMQL L  +    A L+HCF WELP+GM P+ELD
Sbjct: 430 LKPGVPDFKGSHFEFIPFGSGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSELD 489

Query: 180 MTEEFGLVTYRAKHLLAVPSYRL 202
           M + FGL   RA  L+AVP+YRL
Sbjct: 490 MNDVFGLTAPRATRLVAVPTYRL 512


Length = 516

>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information
>gnl|CDD|234794 PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02966502 cytochrome P450 83A1 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02655466 ent-kaurene oxidase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=5.2e-55  Score=366.34  Aligned_cols=197  Identities=34%  Similarity=0.553  Sum_probs=178.9

Q ss_pred             cccccccchHHHHHHHHHHHHhChHHHHHHHHHHHHHhCCCCCCCccccCCChhHHHHHHhhcCCCCCCCCCCccccCCC
Q 036473            2 MLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMED   81 (204)
Q Consensus         2 ~~~ag~~tt~~~l~~~l~~L~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~l~~l~a~i~E~lRl~p~~~~~~~r~~~~~   81 (204)
                      +++||+||||++|++++|+|++||++|+|||+||++++.....++++.+.+|+||++||+||||+||+++.. .|.+.+|
T Consensus       302 Fl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~-~R~C~k~  380 (499)
T KOG0158|consen  302 FLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLYPPAPFL-NRECTKD  380 (499)
T ss_pred             HHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhCCCcccc-cceecCc
Confidence            689999999999999999999999999999999999977665699999999999999999999999999995 8999999


Q ss_pred             ceec-cEEeCCCCEEEEeehhhccCCCCCCCCCCCCCCccCCCCCCCCCCCCceeeccCCCCCCccHHHHHHHHHHHHHH
Q 036473           82 CTVN-GFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQ  160 (204)
Q Consensus        82 ~~~~-g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~pFg~G~r~C~G~~lA~~~~~~~la~  160 (204)
                      +++. ++.|+||+.|.++.+++||||++|+||++|+||||.+++.+ ...+..|+|||.|||+|+|++||++|+|+.++.
T Consensus       381 ~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~-~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~  459 (499)
T KOG0158|consen  381 YEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNK-SRHPGAYLPFGVGPRNCIGMRFALMEAKLALAH  459 (499)
T ss_pred             eecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCccc-ccCCccccCCCCCccccHHHHHHHHHHHHHHHH
Confidence            9999 99999999999999999999999999999999999987654 446779999999999999999999999999999


Q ss_pred             HhhhceeecCCCCCCCcCCcccccceeeecCCceeEEeeecC
Q 036473          161 LVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRL  202 (204)
Q Consensus       161 ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  202 (204)
                      ||++|+++..+...+ . ......+.++.|+.++.+++++|.
T Consensus       460 lL~~f~~~~~~~t~~-~-~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  460 LLRNFSFEVCPTTII-P-LEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             HHhhCEEecCCcccC-c-ccCCccceeeecCCceEEEEEeCC
Confidence            999999998773222 2 222234788899999999999985



>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-30
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 5e-30
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 3e-27
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 8e-26
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 9e-26
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 9e-26
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 3e-23
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 5e-23
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-22
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-22
3pm0_A507 Structural Characterization Of The Complex Between 8e-22
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 1e-19
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-19
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 4e-19
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 7e-18
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 3e-17
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 4e-17
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 5e-17
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 6e-17
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 7e-17
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 1e-16
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 3e-16
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 3e-16
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 3e-16
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 4e-16
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 2e-15
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-15
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 3e-15
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 3e-15
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-15
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 4e-15
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-15
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 7e-15
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 1e-14
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 1e-14
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 2e-14
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 2e-14
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-14
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-14
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-14
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 4e-14
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 4e-14
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 4e-14
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 4e-14
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 4e-14
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 4e-14
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-14
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 4e-14
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 4e-14
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 4e-14
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 4e-14
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-14
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 6e-14
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 7e-14
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 7e-14
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 8e-14
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 8e-14
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 8e-14
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 8e-14
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 8e-14
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 8e-14
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 8e-14
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 8e-14
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 9e-14
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 9e-14
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 9e-14
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-13
1fah_A471 Structure Of Cytochrome P450 Length = 471 1e-13
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-13
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-13
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 1e-13
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 1e-13
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 1e-13
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 1e-13
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 1e-13
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-13
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 2e-13
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-13
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 3e-13
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 3e-13
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-13
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 6e-13
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 6e-13
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 7e-13
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 7e-13
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 1e-11
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 1e-11
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 4e-10
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 9e-10
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 2e-09
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 2e-09
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 2e-09
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 2e-09
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 2e-09
3b98_A475 Crystal Structure Of Zebrafish Prostacyclin Synthas 1e-07
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 3e-07
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 3e-07
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 9e-07
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 9e-07
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 9e-07
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 9e-07
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 9e-07
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 1e-06
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 9e-06
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 3e-05
3b6h_A498 Crystal Structure Of Human Prostacyclin Synthase In 6e-05
2iag_A482 Crystal Structure Of Human Prostacyclin Synthase Le 6e-05
1z8q_A404 Ferrous Dioxygen Complex Of The A245t Cytochrome P4 9e-05
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 9e-05
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 1e-04
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 1e-04
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 1e-04
1z8p_A404 Ferrous Dioxygen Complex Of The A245s Cytochrome P4 1e-04
1z8o_A404 Ferrous Dioxygen Complex Of The Wild-Type Cytochrom 1e-04
1jip_A403 P450eryf(A245s)KETOCONAZOLE Length = 403 2e-04
1jio_A403 P450eryf/6deb Length = 403 2e-04
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 2e-04
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 2e-04
1egy_A403 Cytochrome P450eryf With 9-Aminophenanthrene Bound 5e-04
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure

Iteration: 1

Score = 128 bits (322), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 66/195 (33%), Positives = 107/195 (54%), Gaps = 7/195 (3%) Query: 1 DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV 60 D+ DT T + W+L L+ P + +K+Q+EL+ ++G +R SD L YL+ + Sbjct: 289 DIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLSDRPQLPYLEAFI 348 Query: 61 KETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERF 120 ET R P PH + D T+NGF+IPKK V VN W + DP+ W DP +F PERF Sbjct: 349 LETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPELWEDPSEFRPERF 408 Query: 121 V---GSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTE 177 + G++++ + +++ FG G+R C G LA + A L+ ++ +P G+ + Sbjct: 409 LTADGTAIN-KPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLEFSVPPGV---K 464 Query: 178 LDMTEEFGLVTYRAK 192 +D+T +GL A+ Sbjct: 465 VDLTPIYGLTMKHAR 479
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3B98|A Chain A, Crystal Structure Of Zebrafish Prostacyclin Synthase (Cytochrome P450 8a1) Length = 475 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3B6H|A Chain A, Crystal Structure Of Human Prostacyclin Synthase In Complex With Inhibitor Minoxidil Length = 498 Back     alignment and structure
>pdb|2IAG|A Chain A, Crystal Structure Of Human Prostacyclin Synthase Length = 482 Back     alignment and structure
>pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|1Z8P|A Chain A, Ferrous Dioxygen Complex Of The A245s Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1Z8O|A Chain A, Ferrous Dioxygen Complex Of The Wild-Type Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE Length = 403 Back     alignment and structure
>pdb|1JIO|A Chain A, P450eryf/6deb Length = 403 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|1EGY|A Chain A, Cytochrome P450eryf With 9-Aminophenanthrene Bound Length = 403 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 7e-92
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-86
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-83
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-82
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-64
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-59
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 6e-57
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-52
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-52
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-49
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-48
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-48
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-48
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 4e-48
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 9e-48
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-47
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-46
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-46
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-46
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-45
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 9e-45
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-44
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-44
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-44
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-41
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 4e-38
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-36
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-36
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 8e-31
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 1e-09
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 2e-09
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 3e-09
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 4e-09
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 5e-09
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 6e-09
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 8e-09
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 1e-08
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 1e-08
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 2e-08
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 2e-08
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-08
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 3e-08
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 3e-08
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 3e-08
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 4e-08
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 4e-08
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 5e-08
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 7e-08
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 1e-07
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 2e-07
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 2e-07
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 3e-07
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 3e-07
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 4e-07
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 4e-07
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 4e-07
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 6e-07
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 7e-07
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 8e-07
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 9e-07
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 1e-06
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-06
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 1e-06
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 1e-06
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 2e-06
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 5e-06
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 6e-06
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 6e-06
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 2e-05
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 4e-05
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 7e-05
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 1e-04
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-04
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 2e-04
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 9e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  275 bits (706), Expect = 7e-92
 Identities = 45/218 (20%), Positives = 85/218 (38%), Gaps = 20/218 (9%)

Query: 1   DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV 60
             L      +     W +  L+ HP  ++ ++ E++   G K +  E   +N    D V+
Sbjct: 260 LQLWVTQGNAGPAAFWVMGYLLTHPEALRAVREEIQ---GGKHLRLEERQKNTPVFDSVL 316

Query: 61  KETLRLHPVAPLMAPHESMEDCTV-----NGFHIPKKSRVIVNAW-AIGRDPKAWNDPEK 114
            ETLRL   A +    +  +D  +       +H+ +  R+ V  + +   DP+    PE 
Sbjct: 317 WETLRLTAAALI--TRDVTQDKKICLSNGQEYHLRRGDRLCVFPFISPQMDPQIHQQPEM 374

Query: 115 FFPERFVGSSVDVRGR--------DFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFD 166
           F  +RF+ +    +           +  +P+G+    CPG   A+  +K++   ++  FD
Sbjct: 375 FQFDRFLNADRTEKKDFFKNGARVKYPSVPWGTEDNLCPGRHFAVHAIKELVFTILTRFD 434

Query: 167 WELPEGMLPTELDMTEEFGL-VTYRAKHLLAVPSYRLS 203
            EL +      L     +G  +   A  L      R  
Sbjct: 435 VELCDKNATVPLVDPSRYGFGILQPAGDLEIRYRIRFH 472


>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-55  Score=372.59  Aligned_cols=198  Identities=28%  Similarity=0.503  Sum_probs=177.7

Q ss_pred             cccccccchHHHHHHHHHHHHhChHHHHHHHHHHHHHhCCCCCCCccccCCChhHHHHHHhhcCCCCCCCCCCccccCCC
Q 036473            2 MLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMED   81 (204)
Q Consensus         2 ~~~ag~~tt~~~l~~~l~~L~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~l~~l~a~i~E~lRl~p~~~~~~~r~~~~~   81 (204)
                      +++||+|||+++++|++++|++||++|+|||+||+.+++.+...+.+++.+||||+|||+|+||++|+++...+|.+.+|
T Consensus       280 ~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d  359 (479)
T 3tbg_A          280 LFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRD  359 (479)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSC
T ss_pred             HHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeeeccccccccccceeecCCC
Confidence            67899999999999999999999999999999999999888889999999999999999999999999999878888999


Q ss_pred             ceeccEEeCCCCEEEEeehhhccCCCCCCCCCCCCCCccCCCCCCCCCCCCceeeccCCCCCCccHHHHHHHHHHHHHHH
Q 036473           82 CTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQL  161 (204)
Q Consensus        82 ~~~~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~pFg~G~r~C~G~~lA~~~~~~~la~l  161 (204)
                      ++++||.||+|+.|.++.+++||||++|+||++|+||||++++.+. ..+.+|+|||+|+|.|+|++||++|+++++|.|
T Consensus       360 ~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~-~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~l  438 (479)
T 3tbg_A          360 IEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHF-VKPEAFLPFSAGRRACLGEPLARMELFLFFTSL  438 (479)
T ss_dssp             EEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCB-CCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHH
T ss_pred             ceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCccc-CCCCceecCCCCCcCChhHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999876442 346689999999999999999999999999999


Q ss_pred             hhhceeecCCCCCCCcCCcccccceeeecCCceeEEeeecCC
Q 036473          162 VHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRLS  203 (204)
Q Consensus       162 l~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~  203 (204)
                      |++|||+++++..  ..+.....+++..|+ ++.++++||++
T Consensus       439 l~~f~~~~~~~~~--~~~~~~~~~~~~~P~-~~~v~~~pRs~  477 (479)
T 3tbg_A          439 LQHFSFSVPTGQP--RPSHHGVFAFLVSPS-PYELCAVPRHH  477 (479)
T ss_dssp             HHHEEEECCTTSC--CCCSCEEESSSEEEC-CCCBEEEEC--
T ss_pred             HHccEEEeCCCCC--CccccccceeeecCC-CeEEEEEECCC
Confidence            9999999987732  223334456666664 79999999986



>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-43
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-42
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-40
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-33
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 6e-28
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-23
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-20
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 5e-16
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 5e-16
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 7e-16
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 7e-15
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 1e-14
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-14
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 4e-14
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 6e-14
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-12
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-12
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 9e-12
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-11
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 2e-11
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-11
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score =  147 bits (371), Expect = 6e-43
 Identities = 47/194 (24%), Positives = 86/194 (44%), Gaps = 3/194 (1%)

Query: 1   DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV 60
            +     +T+ T + +    ++K+P V +++Q+E+E ++G  R     D   + Y D V+
Sbjct: 267 SLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVI 326

Query: 61  KETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERF 120
            E  RL  + P   PH   +D    G+ IPK + V     +   DP+ +  P  F P  F
Sbjct: 327 HEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHF 386

Query: 121 VGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDM 180
           + ++  ++ R+   +PF  G+R C G  +A T +      ++  F    P    P ++D+
Sbjct: 387 LDANGALK-RNEGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVP--PEDIDL 443

Query: 181 TEEFGLVTYRAKHL 194
           T     V       
Sbjct: 444 TPRESGVGNVPPSY 457


>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9.6e-53  Score=349.25  Aligned_cols=196  Identities=30%  Similarity=0.500  Sum_probs=178.6

Q ss_pred             cccccccchHHHHHHHHHHHHhChHHHHHHHHHHHHHhCCCCCCCccccCCChhHHHHHHhhcCCCCCCCCCCccccCCC
Q 036473            2 MLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVKETLRLHPVAPLMAPHESMED   81 (204)
Q Consensus         2 ~~~ag~~tt~~~l~~~l~~L~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~l~~l~a~i~E~lRl~p~~~~~~~r~~~~~   81 (204)
                      +++||+|||+++++|++++|++||++|+||++||+.+.+..+.++.+++.+||||+||++|++|++|+++....|.+.+|
T Consensus       268 ~l~ag~~tt~~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~~~~~~~~~l~~lp~l~a~~~Et~Rl~~~~~~~~~r~~~~~  347 (463)
T d3czha1         268 LIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSED  347 (463)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHCSSTTCSCEECSSC
T ss_pred             HHhhhhccchhhhhhHHHhhccCcHHHHHHHHHHHhhcCCCCCCCHHHHHhhhhcccccceeeeeeccccccceecccCC
Confidence            68899999999999999999999999999999999999888888999999999999999999999999998888999999


Q ss_pred             ceeccEEeCCCCEEEEeehhhccCCCCCCCCCCCCCCccCCCCCCCCCCCCceeeccCCCCCCccHHHHHHHHHHHHHHH
Q 036473           82 CTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFVGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQL  161 (204)
Q Consensus        82 ~~~~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~pFg~G~r~C~G~~lA~~~~~~~la~l  161 (204)
                      +.++|+.||||+.|.++.+++|+||++|+||++|+||||++++.. ...+..|+|||+|+|.|+|++||++|+++++|.|
T Consensus       348 ~~~~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~-~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~l  426 (463)
T d3czha1         348 AVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGY-FAKKEALVPFSLGRRHCLGEHLARMEMFLFFTAL  426 (463)
T ss_dssp             EEETTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBCTTSC-BCCCTTCCTTCCSTTCCTTHHHHHHHHHHHHHHH
T ss_pred             cccCCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCCCccc-cCCCCceeCCCCCCcCCchHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999987644 3345689999999999999999999999999999


Q ss_pred             hhhceeecCCCCCCCcCCcccccceeeecCCceeEEeeecC
Q 036473          162 VHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRL  202 (204)
Q Consensus       162 l~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  202 (204)
                      |++|||+++++.   ..++....++++.|+ ++.+++++|+
T Consensus       427 l~~f~~~~~~~~---~~~~~~~~~~~~~p~-~~~v~~~~R~  463 (463)
T d3czha1         427 LQRFHLHFPHEL---VPDLKPRLGMTLQPQ-PYLICAERRH  463 (463)
T ss_dssp             HHHEEEECGGGC---CCCCCCCSSSSCCCC-CCCBEEEECC
T ss_pred             HHhcEEEeCCCC---CCCceeccCeEEecc-CcEEEEEeCc
Confidence            999999997763   334555667776665 7789999995



>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure