Citrus Sinensis ID: 036474


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640------
MITGKDIYDVLAAIVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFISLNDPYAMNYHFIAADSLQKVVILAALFLWQAFTKHGNLEWMITLFSLSTLPNTLVMGIPLLKAMYGDDSGSLMVQVVVLQSVIWYTLMLFMFEYRGAKLLITEQFPETAGSITSFRVDSDVVSLNGREPLQTDAEIGDDGKLHVVVRRSSASSIVSSFNKSHGLNSLTSMTPRASNLTGVEIYSVQSSREPTPRASSFNQNDFYAMFASKAPSPKHGYTNSFQGGIGDVYSLQSSKGATPRTSNFDEEMFKLGNKKRGGRSMSGELFNGGLVSSYPPPNPMFSGGTSAGARKKESAGGGGSGGGAAPAGVPNNKELHMFVWSSTASPVSEGNLRHAVNRAASADFAGVDSSNKAALYHENAASKAMHELIENMSPASKVNGERNLEIEDGSKFPSSGSPYSCQKKMVMEEGDAAKKHQMPPASVMTRLILIMVWRKLIRNPNTYSSVLGLIWSLVSYRWHIKMPTIMSGSISILSDAGLGMAMFSLGLFMALQPKIIACGKSVATFAMAVRFLTGPAVIAATSIAIGLRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITILYYVLLGL
cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccEEEEccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHccccHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
**TGKDIYDVLAAIVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFISLNDPYAMNYHFIAADSLQKVVILAALFLWQAFTKHGNLEWMITLFSLSTLPNTLVMGIPLLKAMYGDDSGSLMVQVVVLQSVIWYTLMLFMFEYRGAKLLITEQFPETAGSITSFRVDSDVVSL*****************LHVV*******************************LTGVEI*******************DFYAMF*************************************************************************************************************HMFVWSS*A**************************************************************************************************VMTRLILIMVWRKLIRNPNTYSSVLGLIWSLVSYRWHIKMPTIMSGSISILSDAGLGMAMFSLGLFMALQPKIIACGKSVATFAMAVRFLTGPAVIAATSIAIGLRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITILYYVLLGL
xxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITGKDIYDVLAAIVPLYVAMILAYGSVRWWKIFTPDQCSGINRFVAVFAVPLLSFHFISLNDPYAMNYHFIAADSLQKVVILAALFLWQAFTKHGNLEWMITLFSLSTLPNTLVMGIPLLKAMYGDDSGSLMVQVVVLQSVIWYTLMLFMFEYRGAKLLITEQFPETAGSITSFRVDSDVVSLNGREPLQTDAEIGDDGKLHVVVRRSSASSIVSSFNKSHGLNSLTSMTPRASNLTGVEIYSVQSSREPTPRASSFNQNDFYAMFASKAPSPKHGYTNSFQGGIGDVYSLQSSKGATPRTSNFDEEMFKLGNKKRGGRSMSGELFNGGLVSSYPPPNPMFSGGTSAGARKKESAGGGGSGGGAAPAGVPNNKELHMFVWSSTASPVSEGNLRHAVNRAASADFAGVDSSNKAALYHENAASKAMHELIENMSPASKVNGERNLEIEDGSKFPSSGSPYSCQKKMVMEEGDAAKKHQMPPASVMTRLILIMVWRKLIRNPNTYSSVLGLIWSLVSYRWHIKMPTIMSGSISILSDAGLGMAMFSLGLFMALQPKIIACGKSVATFAMAVRFLTGPAVIAATSIAIGLRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITILYYVLLGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Auxin efflux carrier component 2 Acts as a component of the auxin efflux carrier. Seems to be involved in the root-specific auxin transport, and mediates the root gravitropism. Its particular localization suggest a role in the translocation of auxin towards the elongation zone.confidentQ9LU77
Probable auxin efflux carrier component 2 May act as a component of the auxin efflux carrier.probableQ651V6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZUX, chain A
Confidence level:confident
Coverage over the Query: 490-618
View the alignment between query and template
View the model in PyMOL
Template: 3ZUX, chain A
Confidence level:probable
Coverage over the Query: 71-149
View the alignment between query and template
View the model in PyMOL