Citrus Sinensis ID: 036521


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600--
VTCPNMMEFLESLGADMEISNMSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGTRRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSKVNQKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVNEAGLQVTN
cccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHcccccHHHHHHcccccccccccccHHHHHHccHHHHHHHHHccccccccccccEEEcccccHHHHHHHHHHHHccccEEEcccccEEEEEEcccEEEEEccccEEEccEEEEEccHHHHHHHccccccHHHHHHcccccccccEEEEEccccccccccccEEEEEccccccccEEEEEEcccccccccccccccEEEEcccccccccEEEEEEEccccccHHHHHHHHHHHHHHccccEEEccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEEcccccccccEEEEEEEcHHHHHHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccccc
cccHHHHHHHHHcccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccHHHHHHccHHHHHHHHcccHHHHHHccHHHHHHHHHHcccEEEcccccEEEEccccHHHHHHHHHHHccccccEEccccEEEEEEccccEEEEEccccEEEccEEEEEEcHHHHHHHHcccccHHHHHHHHccccccccEEEEcccccccccHHHHHHHHHccccccccEEEEHHHHHcccccccccccEEEEEcccccHHHHEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccEEEEEcccccccccEEEEEEccHHHHHHHHHHHcccHHHHHEccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHcccEEcc
VTCPNMMEFLESLGadmeisnmsfskknvlgPYFWQIIREIMKFKDDVLCYLEelennpdidrdeTLGQFIKsrgyselfQKAYlvpicgsiwscpsegimsfSAFSILSFYRNHHLLqlfgrpqwltvrsrSHSYVNKVIALLESLgcqiktgcevcsvlqydegrtevrgdgfqgfydgcimavhapdalrilgnqsTFEEKRLLGAFQYVYSDiflhrdknfmprnpaawsawnflggldgkACLTYWLNVLQnigdgetglpflvtlnpdhtpnntllkwstghpvpsvaasKASLELDHIQGKRGIWFCeayqgygfhedglKAGMIAAHGVLGkrcaslcnprnmvpSLMERGARLFVARFLKQFVCAGCLILLEevgttftfegtrrycnlrtvlrihnpQFYWKVMTHAdlgladsyidgdfsfadKEEGLLNLIMILIAIRDLDASVskvnqkrgwwtpllftsGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMdesmtyscpifkdedEDLKVAQMRKHSLQIEKARVskghgvleigcgwGTFAIEVVRQtgcnytgiTLSAEQLKYAEMKVNEAGLQVTN
VTCPNMMEFLESLGADMEISNMSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELennpdidrdeTLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGTRRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSKVNqkrgwwtpllFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVNEAGLQVTN
VTCPNMMEFLESLGADMEISNMSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLeevgttftfegtRRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSKVNQKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVNEAGLQVTN
*********************MSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGTRRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSKVNQKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQM**HSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAE************
VTCPNMMEFLESLGADMEISNMSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTF*****YCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDA*****NQKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVN*AGL****
VTCPNMMEFLESLGADMEISNMSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGTRRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSKVNQKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVNEAGLQVTN
VTCPNMMEFLESLGADMEISNMSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGTRRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSK**QKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVNEAGLQVT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VTCPNMMEFLESLGADMEISNMSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGTRRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSKVNQKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVNEAGLQVTN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query602 2.2.26 [Sep-21-2011]
P0A9H7 382 Cyclopropane-fatty-acyl-p N/A no 0.282 0.445 0.341 2e-16
P0A9H8 382 Cyclopropane-fatty-acyl-p yes no 0.282 0.445 0.341 2e-16
P31049 394 Probable fatty acid methy no no 0.205 0.314 0.379 2e-16
Q49807 308 Cyclopropane mycolic acid yes no 0.179 0.350 0.398 5e-16
Q7U1J9 287 Cyclopropane mycolic acid no no 0.177 0.372 0.373 3e-14
Q79FX6 287 Cyclopropane mycolic acid no no 0.177 0.372 0.373 3e-14
A5U029 287 Cyclopropane mycolic acid no no 0.177 0.372 0.373 3e-14
P0C5C2 287 Cyclopropane mycolic acid no no 0.161 0.337 0.381 5e-14
A5U866 287 Cyclopropane mycolic acid no no 0.161 0.337 0.381 5e-14
P0A5P0 302 Cyclopropane mycolic acid no no 0.162 0.324 0.397 1e-13
>sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 98/208 (47%), Gaps = 38/208 (18%)

Query: 402 LRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSKV-- 459
           +R+ NP F+ +V+    LGL +SY+DG +   D+                LD   SKV  
Sbjct: 39  IRVKNPDFFKRVLQEGSLGLGESYMDGWWE-CDR----------------LDMFFSKVLR 81

Query: 460 ----NQKRGWWTPLLF--TSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFM 513
               NQ      P  F  T  IA A  F     +R  +         HYDL N+LF+  +
Sbjct: 82  AGLENQ-----LPHHFKDTLRIAGARLFNLQSKKRAWIVGKE-----HYDLGNDLFSRML 131

Query: 514 DESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTG 573
           D  M YSC  +KD D +L+ AQ  K  +  EK ++  G  VL+IGCGWG  A  +     
Sbjct: 132 DPFMQYSCAYWKDAD-NLESAQQAKLKMICEKLQLKPGMRVLDIGCGWGGLAHYMASNYD 190

Query: 574 CNYTGITLSAEQLKYAEMKVNEAGLQVT 601
            +  G+T+SAEQ K A+ +    GL VT
Sbjct: 191 VSVVGVTISAEQQKMAQERCE--GLDVT 216




Transfers a methylene group from S-adenosyl-L-methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge.
Escherichia coli (strain K12) (taxid: 83333)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 9
>sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 Back     alignment and function description
>sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 Back     alignment and function description
>sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 Back     alignment and function description
>sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 Back     alignment and function description
>sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis GN=mmaA2 PE=1 SV=1 Back     alignment and function description
>sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 Back     alignment and function description
>sp|P0C5C2|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis GN=cmaA1 PE=1 SV=1 Back     alignment and function description
>sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 Back     alignment and function description
>sp|P0A5P0|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis GN=cmaA2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
224099967 862 predicted protein [Populus trichocarpa] 0.986 0.689 0.723 0.0
225433227 865 PREDICTED: uncharacterized protein LOC10 0.991 0.690 0.723 0.0
296083708 898 unnamed protein product [Vitis vinifera] 0.991 0.664 0.712 0.0
224107479 866 predicted protein [Populus trichocarpa] 0.991 0.689 0.719 0.0
359477758 865 PREDICTED: uncharacterized protein LOC10 0.991 0.690 0.713 0.0
255575825 865 methyltransferase, putative [Ricinus com 0.991 0.690 0.705 0.0
50313464 865 cyclopropane fatty acid synthase [Gossyp 0.991 0.690 0.705 0.0
147791135 874 hypothetical protein VITISV_025151 [Viti 0.970 0.668 0.704 0.0
449458900 1611 PREDICTED: uncharacterized protein LOC10 0.991 0.370 0.680 0.0
296083705 881 unnamed protein product [Vitis vinifera] 0.991 0.677 0.678 0.0
>gi|224099967|ref|XP_002311690.1| predicted protein [Populus trichocarpa] gi|222851510|gb|EEE89057.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/622 (72%), Positives = 517/622 (83%), Gaps = 28/622 (4%)

Query: 1   VTCPNMMEFLESLGADMEISNMSFS-----------------------KKNVLGPYFWQI 37
           VT PNMMEF ESLG DME+S+MSFS                       KKN+L PYFW++
Sbjct: 59  VTYPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLNPYFWKM 118

Query: 38  IREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPS 97
           +REI+KFKDDVL YLE LENNPD+DR+ETLG+F+KSRGYSELFQKAYL+P+CGSIWSCPS
Sbjct: 119 LREIIKFKDDVLSYLEMLENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPS 178

Query: 98  EGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEV 157
           EG+MSFSAFS+LSF RNHHLL++FGRPQWLTV  RSHSYV+KV   LES GCQI+TGCE+
Sbjct: 179 EGVMSFSAFSVLSFCRNHHLLEVFGRPQWLTVTRRSHSYVDKVREKLESWGCQIRTGCEI 238

Query: 158 CSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDI 217
            +V   DE       DG    Y GCIMAVHAPDAL +LG Q+TF+E R+LGAFQY+YSDI
Sbjct: 239 QAVSTTDEVLCR---DGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGAFQYMYSDI 295

Query: 218 FLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTP 277
           FLHRDK FMP+N AAWSAWNFLG  D K CLTYWLNVLQNI   ETGLPFLVTLNPDH P
Sbjct: 296 FLHRDKKFMPQNSAAWSAWNFLGSTDNKVCLTYWLNVLQNID--ETGLPFLVTLNPDHAP 353

Query: 278 NNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGV 337
           ++TL+KWSTGHPVPSVAA+KASLELDHIQGKR IWFC AYQGYGFHEDGLK+GM+AAHG+
Sbjct: 354 DHTLVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMVAAHGL 413

Query: 338 LGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGTRRYCN 397
           LG  CA L NP++M PS++E GARLFV RFL  ++  GCLILLEE GT F+FEGT + C+
Sbjct: 414 LGNSCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGTSKKCS 473

Query: 398 LRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVS 457
           L+TVL++HNPQFYWK+MT ADLGLAD+YI+GDFSF +K+EGLLNL MILI  RD + S S
Sbjct: 474 LKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLFMILIVNRDANKSAS 533

Query: 458 KVNQKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESM 517
           K+N+KRGWWTPLLFT+GIASA +F++HISR+N+L QARRNIS HYDLSNELFALF+DE+M
Sbjct: 534 KLNKKRGWWTPLLFTAGIASAKFFIQHISRQNTLTQARRNISRHYDLSNELFALFLDETM 593

Query: 518 TYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYT 577
           TYSC +FK EDEDLK AQMRK SL IEKAR+SK H +LEIGCGWGT AIE V++TGC YT
Sbjct: 594 TYSCGVFKTEDEDLKDAQMRKISLLIEKARISKDHEILEIGCGWGTLAIEAVQRTGCKYT 653

Query: 578 GITLSAEQLKYAEMKVNEAGLQ 599
           GITLS EQLKYAEMKV EAGLQ
Sbjct: 654 GITLSEEQLKYAEMKVKEAGLQ 675




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225433227|ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083708|emb|CBI23697.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224107479|ref|XP_002314493.1| predicted protein [Populus trichocarpa] gi|222863533|gb|EEF00664.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359477758|ref|XP_002281923.2| PREDICTED: uncharacterized protein LOC100242555 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575825|ref|XP_002528810.1| methyltransferase, putative [Ricinus communis] gi|223531722|gb|EEF33544.1| methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|50313464|gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|147791135|emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458900|ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus] Back     alignment and taxonomy information
>gi|296083705|emb|CBI23694.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
TAIR|locus:2088070 867 AT3G23530 [Arabidopsis thalian 0.965 0.670 0.672 2.1e-224
TAIR|locus:2088712 867 AT3G23510 [Arabidopsis thalian 0.965 0.670 0.671 5.7e-224
TAIR|locus:2088717 461 AT3G23470 [Arabidopsis thalian 0.446 0.583 0.605 8e-85
TAIR|locus:2090915305 AT3G23460 [Arabidopsis thalian 0.327 0.645 0.542 8.6e-56
UNIPROTKB|Q48MU4415 PSPPH_1007 "Uncharacterized pr 0.501 0.727 0.344 2e-47
UNIPROTKB|Q0C192438 HNE_1797 "Putative uncharacter 0.534 0.735 0.336 2.3e-46
UNIPROTKB|Q5LTD2447 SPO1482 "Uncharacterized prote 0.488 0.657 0.350 1.5e-44
TIGR_CMR|SPO_1482447 SPO_1482 "conserved hypothetic 0.488 0.657 0.350 1.5e-44
UNIPROTKB|Q9KSY6426 VC_1120 "Putative uncharacteri 0.493 0.697 0.334 4.8e-39
TIGR_CMR|VC_1120426 VC_1120 "conserved hypothetica 0.493 0.697 0.334 4.8e-39
TAIR|locus:2088070 AT3G23530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2096 (742.9 bits), Expect = 2.1e-224, Sum P(2) = 2.1e-224
 Identities = 395/587 (67%), Positives = 463/587 (78%)

Query:    14 GADMEISNMSFSKKNVLGPYFWQIIREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKS 73
             G+   +S +   KKNVL PYFWQ+IREI++FK+DVL Y+EELE NPDIDR ETLG+F+ S
Sbjct:    96 GSRNGVSGLFAQKKNVLNPYFWQMIREIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNS 155

Query:    74 RGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRS 133
             RGYSELFQ+AYLVPICGSIWSCPS+G++SFSA+S+LSF  NHHLLQ+FGRPQWLTV  RS
Sbjct:   156 RGYSELFQQAYLVPICGSIWSCPSDGVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRS 215

Query:   134 HSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTEVR-GDGFQGFYDGCIMAVHAPDAL 192
              +YV KV   LE LGC+I+T C+V SV   + G   V  GDG +  +D CI+A+HAPDAL
Sbjct:   216 QTYVAKVRTELERLGCRIRTSCDVKSVSTSENGCVTVTSGDGSKEVFDRCILAMHAPDAL 275

Query:   193 RILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWL 252
             R+LG + TF+E R+LGAFQYVYSDI+LH D + MPRN AAWSAWNFLG  + K C+TYWL
Sbjct:   276 RLLGEEVTFDESRVLGAFQYVYSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWL 335

Query:   253 NVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIW 312
             N+LQN+G  E   PF VTLNPD TP  TLLKW+TGHPVPSVAA  AS EL  IQGKR IW
Sbjct:   336 NILQNLG--ENSEPFFVTLNPDETPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIW 393

Query:   313 FCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFV 372
             FC AYQGYGFHEDGLKAGM AA G+LGK  A L NPR+MVPSL E GARLFV RFL QF+
Sbjct:   394 FCGAYQGYGFHEDGLKAGMAAARGLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFI 453

Query:   373 CAGCLILLXXXXXXXXXXXXRRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSF 432
               G + +L               C L+++L+IH+PQFYWKVMT ADLGLAD+YI+GDFSF
Sbjct:   454 STGSVTILEEGGTMFTFGGKDSTCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSF 513

Query:   433 ADKEEGLLNLIMILIAIRDLDASVSKVNQKRGWWTPLLFTSGIASASYFLRHISRRNSLA 492
              DKE GLLNLIMILIA RD  +++SK   KRGWWTP+  T+G+ASA YFL+H+SR+N+L 
Sbjct:   514 VDKESGLLNLIMILIANRDTKSNLSK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLT 570

Query:   493 QARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGH 552
             QARRNIS HYDLSNELF  F+D++MTYS  +FK +DEDL+ AQMRK SL I+KAR+ K H
Sbjct:   571 QARRNISRHYDLSNELFGFFLDDTMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDH 630

Query:   553 GVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVNEAGLQ 599
              VLEIGCGWGT AIEVVR+TGC YTGITLS EQLKYAE KV EAGLQ
Sbjct:   631 EVLEIGCGWGTLAIEVVRRTGCKYTGITLSIEQLKYAEEKVKEAGLQ 677


GO:0005737 "cytoplasm" evidence=ISM
GO:0008610 "lipid biosynthetic process" evidence=IEA;ISS
GO:0008825 "cyclopropane-fatty-acyl-phospholipid synthase activity" evidence=ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2088712 AT3G23510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088717 AT3G23470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090915 AT3G23460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q48MU4 PSPPH_1007 "Uncharacterized protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C192 HNE_1797 "Putative uncharacterized protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LTD2 SPO1482 "Uncharacterized protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1482 SPO_1482 "conserved hypothetical protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KSY6 VC_1120 "Putative uncharacterized protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1120 VC_1120 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_VIII000723
hypothetical protein (862 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.100440002
Predicted protein (291 aa)
     0.754
eugene3.00110420
hypothetical protein (305 aa)
      0.464
estExt_fgenesh4_pg.C_LG_XVIII0095
hypothetical protein (355 aa)
     0.417

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
COG2907447 COG2907, COG2907, Predicted NAD/FAD-binding protei 1e-66
COG2230 283 COG2230, Cfa, Cyclopropane fatty acid synthase and 1e-37
pfam02353 273 pfam02353, CMAS, Mycolic acid cyclopropane synthet 4e-34
PRK11705 383 PRK11705, PRK11705, cyclopropane fatty acyl phosph 2e-28
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 8e-06
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 1e-04
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 2e-04
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 4e-04
>gnl|CDD|225459 COG2907, COG2907, Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
 Score =  223 bits (570), Expect = 1e-66
 Identities = 119/361 (32%), Positives = 179/361 (49%), Gaps = 39/361 (10%)

Query: 1   VTCPNMMEFLESLGADMEISNMSFS----------------------KKNVLGPYFWQII 38
            T PN+    +++G D + S MSFS                      K+N+L P F  ++
Sbjct: 70  RTYPNLTRLFKTIGVDTKASFMSFSVSLDMGGLEYSGLTGLAGLLAQKRNLLRPRFPCML 129

Query: 39  REIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSE 98
            EI++F        +   ++     D TL Q++K R +   F + +L P+  +IWS P  
Sbjct: 130 AEILRFY-----RSDLAPSDNAGQGDTTLAQYLKQRNFGRAFVEDFLQPLVAAIWSTPLA 184

Query: 99  GIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVC 158
               + A + L F  NH LL L  RP W TV   S +YV ++ A    +  +I+T   VC
Sbjct: 185 DASRYPACNFLVFTDNHGLLYLPKRPTWRTVAGGSRAYVQRLAA---DIRGRIETRTPVC 241

Query: 159 SVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIF 218
            + +  +G   V  DG    +D  ++A H   AL +L ++ + EE++LLGA +Y  +   
Sbjct: 242 RLRRLPDGVVLVNADGESRRFDAVVIATHPDQALALL-DEPSPEERQLLGALRYSANTAV 300

Query: 219 LHRDKNFMPRNPAAWSAWNFLG---GLDGKACLTYWLNVLQNIGDGETGLPFLVTLN--P 273
           LH D + MPR   AW++WN+LG       +  LTYW+N LQ +        + VTLN  P
Sbjct: 301 LHTDASLMPRRLRAWASWNYLGTVQWELCQGSLTYWMNRLQALISVR---DYFVTLNNRP 357

Query: 274 DHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIA 333
              P + + + +  HP+    A +A  EL  +QG R  WFC AY G GFHEDGL+AG+  
Sbjct: 358 WVDPAHVIAERTYPHPLFDPEAVRAQQELWALQGARRTWFCGAYFGRGFHEDGLQAGLAV 417

Query: 334 A 334
           A
Sbjct: 418 A 418


Length = 447

>gnl|CDD|225139 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|216988 pfam02353, CMAS, Mycolic acid cyclopropane synthetase Back     alignment and domain information
>gnl|CDD|183282 PRK11705, PRK11705, cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 602
COG2907447 Predicted NAD/FAD-binding protein [General functio 100.0
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 100.0
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 99.96
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.95
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.88
PRK12416463 protoporphyrinogen oxidase; Provisional 99.87
PLN02576496 protoporphyrinogen oxidase 99.85
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.83
PRK11883451 protoporphyrinogen oxidase; Reviewed 99.81
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.8
PLN02487569 zeta-carotene desaturase 99.78
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.76
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.75
PLN02612567 phytoene desaturase 99.75
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 99.74
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.73
PRK07233434 hypothetical protein; Provisional 99.73
PRK07208479 hypothetical protein; Provisional 99.71
PLN02529738 lysine-specific histone demethylase 1 99.62
PLN02268435 probable polyamine oxidase 99.62
PLN02244 340 tocopherol O-methyltransferase 99.6
PLN02328808 lysine-specific histone demethylase 1 homolog 99.46
PLN03000881 amine oxidase 99.46
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.45
PLN02568539 polyamine oxidase 99.4
PLN02976 1713 amine oxidase 99.38
PLN02676487 polyamine oxidase 99.36
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.35
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 99.23
PF01209 233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.13
TIGR02752 231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.97
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.96
PLN02233 261 ubiquinone biosynthesis methyltransferase 98.89
PRK05785 226 hypothetical protein; Provisional 98.85
PRK07580 230 Mg-protoporphyrin IX methyl transferase; Validated 98.8
KOG1540 296 consensus Ubiquinone biosynthesis methyltransferas 98.79
PLN02585 315 magnesium protoporphyrin IX methyltransferase 98.79
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.78
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.78
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.77
PRK11207 197 tellurite resistance protein TehB; Provisional 98.76
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 98.75
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.75
TIGR00477 195 tehB tellurite resistance protein TehB. Part of a 98.75
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.68
PF03848 192 TehB: Tellurite resistance protein TehB; InterPro: 98.67
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.66
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.66
PRK07402 196 precorrin-6B methylase; Provisional 98.66
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.65
PRK08287 187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.65
PRK10258 251 biotin biosynthesis protein BioC; Provisional 98.64
TIGR02021 219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.64
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 98.64
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.64
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.63
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.62
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 98.62
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.59
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.57
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 98.57
KOG1270 282 consensus Methyltransferases [Coenzyme transport a 98.56
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 98.55
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 98.55
PRK12335 287 tellurite resistance protein TehB; Provisional 98.54
PRK00377 198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.53
TIGR03587 204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.52
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.5
PLN02336 475 phosphoethanolamine N-methyltransferase 98.47
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.46
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.45
smart00650 169 rADc Ribosomal RNA adenine dimethylases. 98.43
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.42
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.42
TIGR00740 239 methyltransferase, putative. A simple BLAST search 98.4
KOG1541 270 consensus Predicted protein carboxyl methylase [Ge 98.4
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 98.4
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.4
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.39
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 98.39
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.38
TIGR01934 223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.37
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.37
PRK14967 223 putative methyltransferase; Provisional 98.37
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.37
PLN02490 340 MPBQ/MSBQ methyltransferase 98.37
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.37
KOG1271 227 consensus Methyltransferases [General function pre 98.37
PRK14968 188 putative methyltransferase; Provisional 98.36
TIGR03438 301 probable methyltransferase. This model represents 98.35
PRK00121 202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.34
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.33
TIGR03840 213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.32
TIGR03533 284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.32
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.32
TIGR00537 179 hemK_rel_arch HemK-related putative methylase. The 98.31
COG4976 287 Predicted methyltransferase (contains TPR repeat) 98.31
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.28
TIGR00452 314 methyltransferase, putative. Known examples to dat 98.27
TIGR00091 194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.27
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.27
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.25
TIGR02716 306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.25
PRK04266 226 fibrillarin; Provisional 98.24
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.24
PRK13255 218 thiopurine S-methyltransferase; Reviewed 98.23
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 98.23
COG4123 248 Predicted O-methyltransferase [General function pr 98.22
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.22
TIGR00536 284 hemK_fam HemK family putative methylases. The gene 98.21
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.21
PRK08317 241 hypothetical protein; Provisional 98.21
PRK14966 423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.2
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.2
COG2890 280 HemK Methylase of polypeptide chain release factor 98.2
PRK06202 232 hypothetical protein; Provisional 98.2
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.19
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.18
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.17
PRK04148134 hypothetical protein; Provisional 98.17
PRK11805 307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.16
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.16
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 98.16
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.15
PRK06922 677 hypothetical protein; Provisional 98.15
PF07021 193 MetW: Methionine biosynthesis protein MetW; InterP 98.13
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 98.12
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.1
TIGR03704 251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.1
TIGR03534 251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.1
COG3349485 Uncharacterized conserved protein [Function unknow 98.08
TIGR02081 194 metW methionine biosynthesis protein MetW. This pr 98.07
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.07
PRK10901 427 16S rRNA methyltransferase B; Provisional 98.06
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.06
COG2263 198 Predicted RNA methylase [Translation, ribosomal st 98.05
KOG2904 328 consensus Predicted methyltransferase [General fun 98.04
PRK14903 431 16S rRNA methyltransferase B; Provisional 98.04
PRK14902 444 16S rRNA methyltransferase B; Provisional 98.03
TIGR00446 264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.02
PRK14904 445 16S rRNA methyltransferase B; Provisional 98.01
TIGR00563 426 rsmB ribosomal RNA small subunit methyltransferase 98.01
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.01
TIGR00478 228 tly hemolysin TlyA family protein. Hemolysins are 98.0
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.0
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 97.99
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 97.99
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 97.96
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 97.96
TIGR02143 353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.95
PRK09328 275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.94
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.93
PHA03411 279 putative methyltransferase; Provisional 97.93
PRK14901 434 16S rRNA methyltransferase B; Provisional 97.91
PLN02781 234 Probable caffeoyl-CoA O-methyltransferase 97.9
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 97.89
smart00138 264 MeTrc Methyltransferase, chemotaxis proteins. Meth 97.89
COG2519 256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.88
TIGR01983 224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.88
PRK15128 396 23S rRNA m(5)C1962 methyltransferase; Provisional 97.86
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.86
PLN02336 475 phosphoethanolamine N-methyltransferase 97.84
PRK05031 362 tRNA (uracil-5-)-methyltransferase; Validated 97.83
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.81
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 97.8
COG2081408 Predicted flavoproteins [General function predicti 97.79
PF08704 247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.79
PRK11188 209 rrmJ 23S rRNA methyltransferase J; Provisional 97.77
PLN03075 296 nicotianamine synthase; Provisional 97.76
PF05958 352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 97.75
PF05401 201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.74
PLN02672 1082 methionine S-methyltransferase 97.71
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.7
PTZ00146 293 fibrillarin; Provisional 97.69
PF13679141 Methyltransf_32: Methyltransferase domain 97.65
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.64
PRK13256 226 thiopurine S-methyltransferase; Reviewed 97.64
PF01596 205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.64
TIGR00438 188 rrmJ cell division protein FtsJ. 97.63
PF05724 218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.62
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 97.6
PRK04457 262 spermidine synthase; Provisional 97.58
KOG0820 315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.57
PF02390 195 Methyltransf_4: Putative methyltransferase ; Inter 97.57
PLN02476 278 O-methyltransferase 97.56
PHA03412 241 putative methyltransferase; Provisional 97.54
COG4122 219 Predicted O-methyltransferase [General function pr 97.54
KOG3420185 consensus Predicted RNA methylase [Translation, ri 97.51
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.46
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 97.39
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.38
KOG4300 252 consensus Predicted methyltransferase [General fun 97.37
PF08123 205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.36
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.31
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.31
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 97.31
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.28
KOG1269 364 consensus SAM-dependent methyltransferases [Lipid 97.28
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.28
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.23
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.22
PRK00811 283 spermidine synthase; Provisional 97.2
COG1041347 Predicted DNA modification methylase [DNA replicat 97.18
KOG3010 261 consensus Methyltransferase [General function pred 97.16
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.12
PLN02366 308 spermidine synthase 97.1
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 97.04
KOG2899 288 consensus Predicted methyltransferase [General fun 97.02
PLN02589 247 caffeoyl-CoA O-methyltransferase 96.99
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 96.99
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 96.91
COG0220 227 Predicted S-adenosylmethionine-dependent methyltra 96.9
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 96.88
COG1092 393 Predicted SAM-dependent methyltransferases [Genera 96.84
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 96.8
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 96.8
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 96.79
PRK01581 374 speE spermidine synthase; Validated 96.74
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.71
PF05971 299 Methyltransf_10: Protein of unknown function (DUF8 96.69
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.64
PRK03612 521 spermidine synthase; Provisional 96.61
KOG3191 209 consensus Predicted N6-DNA-methyltransferase [Tran 96.54
PF01728 181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 96.53
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 96.5
PRK10742 250 putative methyltransferase; Provisional 96.43
KOG2915 314 consensus tRNA(1-methyladenosine) methyltransferas 96.38
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 96.35
PRK13977576 myosin-cross-reactive antigen; Provisional 96.34
KOG2730 263 consensus Methylase [General function prediction o 96.33
COG0742187 N6-adenine-specific methylase [DNA replication, re 96.27
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 96.26
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 96.26
PF10672 286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.25
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 96.23
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 96.21
COG2520 341 Predicted methyltransferase [General function pred 96.21
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 96.2
PF06080 204 DUF938: Protein of unknown function (DUF938); Inte 96.19
KOG1501 636 consensus Arginine N-methyltransferase [General fu 96.16
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 95.9
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 95.82
TIGR00275400 flavoprotein, HI0933 family. The model when search 95.69
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 95.64
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 95.55
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 95.51
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 95.37
KOG4058199 consensus Uncharacterized conserved protein [Funct 95.23
PF01189 283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 95.19
KOG3115 249 consensus Methyltransferase-like protein [General 95.14
COG0144 355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 94.86
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 94.83
PRK11524284 putative methyltransferase; Provisional 94.7
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 94.65
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 94.57
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 94.53
COG1189 245 Predicted rRNA methylase [Translation, ribosomal s 94.53
PRK13699227 putative methylase; Provisional 94.45
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 94.41
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 94.41
COG0579429 Predicted dehydrogenase [General function predicti 94.26
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 94.07
KOG2361 264 consensus Predicted methyltransferase [General fun 94.03
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 94.0
PLN02823 336 spermine synthase 94.0
PF11899 380 DUF3419: Protein of unknown function (DUF3419); In 93.96
KOG2078 495 consensus tRNA modification enzyme [RNA processing 93.83
PHA01634156 hypothetical protein 93.82
PF01739 196 CheR: CheR methyltransferase, SAM binding domain; 93.77
COG0293 205 FtsJ 23S rRNA methylase [Translation, ribosomal st 93.76
COG3897218 Predicted methyltransferase [General function pred 93.73
COG2384 226 Predicted SAM-dependent methyltransferase [General 93.73
PF04445 234 SAM_MT: Putative SAM-dependent methyltransferase; 93.64
PF12147 311 Methyltransf_20: Putative methyltransferase; Inter 93.62
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 93.51
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 93.34
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 93.25
KOG0024 354 consensus Sorbitol dehydrogenase [Secondary metabo 93.1
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 92.92
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 92.72
KOG4589 232 consensus Cell division protein FtsJ [Cell cycle c 92.56
PF05219 265 DREV: DREV methyltransferase; InterPro: IPR007884 92.54
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 92.41
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 92.3
PRK11728393 hydroxyglutarate oxidase; Provisional 92.2
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 92.15
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 92.13
COG0500 257 SmtA SAM-dependent methyltransferases [Secondary m 92.06
COG2521 287 Predicted archaeal methyltransferase [General func 91.86
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 91.8
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 91.57
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 91.55
PTZ00383497 malate:quinone oxidoreductase; Provisional 91.37
KOG1663 237 consensus O-methyltransferase [Secondary metabolit 91.26
PRK06847375 hypothetical protein; Provisional 91.21
PRK11259376 solA N-methyltryptophan oxidase; Provisional 91.03
PRK09897534 hypothetical protein; Provisional 90.67
PF01564 246 Spermine_synth: Spermine/spermidine synthase; Inte 90.53
PF04672 267 Methyltransf_19: S-adenosyl methyltransferase; Int 90.4
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 90.3
KOG2940 325 consensus Predicted methyltransferase [General fun 90.3
COG5379 414 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3 90.26
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 90.18
PRK06116450 glutathione reductase; Validated 90.06
COG4076 252 Predicted RNA methylase [General function predicti 90.06
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 89.99
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 89.95
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 89.78
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 89.63
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 89.61
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 89.33
COG0421 282 SpeE Spermidine synthase [Amino acid transport and 89.24
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 89.04
PLN02507499 glutathione reductase 89.03
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 88.94
PF11599 246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 88.71
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 88.62
cd08254 338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 88.55
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 88.5
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 88.47
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 88.4
PRK13339497 malate:quinone oxidoreductase; Reviewed 88.39
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 88.25
PRK05257494 malate:quinone oxidoreductase; Validated 88.2
COG3129 292 Predicted SAM-dependent methyltransferase [General 88.13
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 88.01
PF07942 270 N2227: N2227-like protein; InterPro: IPR012901 Thi 87.81
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 87.79
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 87.76
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 87.6
PRK10611 287 chemotaxis methyltransferase CheR; Provisional 87.4
PLN02172461 flavin-containing monooxygenase FMO GS-OX 87.36
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 87.33
PRK06834488 hypothetical protein; Provisional 87.2
PRK00536 262 speE spermidine synthase; Provisional 86.96
PRK07845466 flavoprotein disulfide reductase; Reviewed 86.94
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 86.75
PRK07236386 hypothetical protein; Provisional 86.74
PRK07588391 hypothetical protein; Provisional 86.6
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 86.47
COG1565 370 Uncharacterized conserved protein [Function unknow 86.46
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 86.29
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 86.27
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 85.99
COG1352 268 CheR Methylase of chemotaxis methyl-accepting prot 85.87
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 85.86
KOG2920 282 consensus Predicted methyltransferase [General fun 85.83
COG0286 489 HsdM Type I restriction-modification system methyl 85.78
PRK07190487 hypothetical protein; Provisional 85.72
TIGR02818 368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 85.68
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 85.55
PF02036102 SCP2: SCP-2 sterol transfer family; InterPro: IPR0 85.25
PLN02740 381 Alcohol dehydrogenase-like 85.22
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 85.18
KOG1331 293 consensus Predicted methyltransferase [General fun 85.14
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 85.05
PRK08163396 salicylate hydroxylase; Provisional 85.04
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 85.0
PF01269 229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 84.87
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 84.83
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 84.68
PRK06753373 hypothetical protein; Provisional 84.59
PRK09126392 hypothetical protein; Provisional 84.43
PF05891 218 Methyltransf_PK: AdoMet dependent proline di-methy 84.37
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 84.02
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 84.02
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 83.99
PRK10157428 putative oxidoreductase FixC; Provisional 83.96
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 83.73
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 83.7
cd08255 277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 83.51
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 83.22
PRK14727479 putative mercuric reductase; Provisional 83.21
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 83.2
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 83.17
PTZ00052499 thioredoxin reductase; Provisional 82.9
PLN02463447 lycopene beta cyclase 82.87
PRK14694468 putative mercuric reductase; Provisional 82.82
PRK06184502 hypothetical protein; Provisional 82.81
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 82.7
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 82.61
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 82.58
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 82.45
PRK06327475 dihydrolipoamide dehydrogenase; Validated 82.24
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 82.03
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 82.01
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 82.0
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 81.9
cd08301 369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 81.88
cd08261 337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 81.62
PRK08274466 tricarballylate dehydrogenase; Validated 81.36
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 81.13
TIGR03366 280 HpnZ_proposed putative phosphonate catabolism asso 81.06
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 80.9
cd08300 368 alcohol_DH_class_III class III alcohol dehydrogena 80.58
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 80.57
PRK06370463 mercuric reductase; Validated 80.3
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 80.05
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=4.6e-55  Score=427.22  Aligned_cols=339  Identities=36%  Similarity=0.625  Sum_probs=308.1

Q ss_pred             CCcHHHHHHHHHcCCCceeeceeec----------------------CccccChHHHHHHHHHHHhhHHHHHHHHhhcCC
Q 036521            1 VTCPNMMEFLESLGADMEISNMSFS----------------------KKNVLGPYFWQIIREIMKFKDDVLCYLEELENN   58 (602)
Q Consensus         1 ~~y~~~~~l~~~lGi~~~~~~~~~~----------------------~~~~~~~~~~~~~~~i~rf~~~~~~~l~~~~~~   58 (602)
                      ++|||+++||+++|+++.++.|+|+                      +.|+++|.++.++.+++||.+....    +.+ 
T Consensus        70 ~tYpnl~~Lf~~iGv~t~as~Msf~v~~d~gglEy~g~tgl~~L~aqk~n~l~pRf~~mlaeiLrf~r~~~~----~~d-  144 (447)
T COG2907          70 RTYPNLTRLFKTIGVDTKASFMSFSVSLDMGGLEYSGLTGLAGLLAQKRNLLRPRFPCMLAEILRFYRSDLA----PSD-  144 (447)
T ss_pred             CCcchHHHHHHHcCCCCcccceeEEEEecCCceeeccCCCccchhhccccccchhHHHHHHHHHHHhhhhcc----chh-
Confidence            5899999999999999999999876                      5667789999999999999884111    100 


Q ss_pred             CCCCCCCCHHHHHHhcCCCHHHHHHHHHHHHhhhcCCChhhHHhhhHHHHHHHHHhcCccccCCCCcEEEecCCcHhHHH
Q 036521           59 PDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVN  138 (602)
Q Consensus        59 ~~~~~~~s~~~~l~~~~~~~~~~~~~~~pl~~~v~~~~~~~~~~~p~~~~l~~~~~~g~~~~~~~~~~~~~~gG~~~l~~  138 (602)
                      -....++|+++||++++|++.|++.++.||+.++|+++..++..+|+.+|+.|+.+||++.+.+.+.|.++.||+..+++
T Consensus       145 ~~~~~~~tl~~~L~~~~f~~af~e~~l~P~~aaiwstp~~d~~~~pa~~~~~f~~nhGll~l~~rp~wrtV~ggS~~yvq  224 (447)
T COG2907         145 NAGQGDTTLAQYLKQRNFGRAFVEDFLQPLVAAIWSTPLADASRYPACNFLVFTDNHGLLYLPKRPTWRTVAGGSRAYVQ  224 (447)
T ss_pred             hhcCCCccHHHHHHhcCccHHHHHHhHHHHHHHHhcCcHhhhhhhhHHHHHHHHhccCceecCCCCceeEcccchHHHHH
Confidence            01235799999999999999999999999999999999999999999999999999999889999999999999999999


Q ss_pred             HHHHHHhcCCCeEEeCCceeEEEecCCeEEEEeCCCcEEecCEEEEecChHHHHhhccCCCCHHHHhhccCccccceeEE
Q 036521          139 KVIALLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIF  218 (602)
Q Consensus       139 ~la~~l~~~g~~v~l~t~V~~i~~~~~gv~v~~~~g~~~~ad~VI~A~p~~~a~~ll~~~~~~~~~~~l~~~~y~~~~~v  218 (602)
                      +|++.+   +++|.++++|..|.+-.+||.|+..+|++..||+||+||+|++|+.||++ ++|+|+++|+.|.|+.+.+|
T Consensus       225 ~laa~~---~~~i~t~~~V~~l~rlPdGv~l~~~~G~s~rFD~vViAth~dqAl~mL~e-~sp~e~qll~a~~Ys~n~aV  300 (447)
T COG2907         225 RLAADI---RGRIETRTPVCRLRRLPDGVVLVNADGESRRFDAVVIATHPDQALALLDE-PSPEERQLLGALRYSANTAV  300 (447)
T ss_pred             HHhccc---cceeecCCceeeeeeCCCceEEecCCCCccccceeeeecChHHHHHhcCC-CCHHHHHHHHhhhhhhceeE
Confidence            999999   78999999999999999999999999988899999999999999999997 99999999999999999999


Q ss_pred             EecCCCCCCCCCCcccccccccC---CCCCeEEEEeccccccCCCCCCCCCeEEEcC--CCCCCcceEEEEEccCCCCCh
Q 036521          219 LHRDKNFMPRNPAAWSAWNFLGG---LDGKACLTYWLNVLQNIGDGETGLPFLVTLN--PDHTPNNTLLKWSTGHPVPSV  293 (602)
Q Consensus       219 l~~d~~l~p~~~~~w~s~n~~~~---~~~~~~~t~~~~~~~~l~~~~~~~~v~~tl~--p~~~p~~~l~r~~~~~p~~~~  293 (602)
                      +|+|+++||.+..+|++|||...   ...+.+++||||.+|++..  . .+.++|+|  |..+|..++++..|+||+|++
T Consensus       301 lhtd~~lmPrR~~Awaswny~~~~~~e~~~~~lty~mN~lq~l~~--~-~~~~vtln~~~~~dpa~v~~~~ty~HPlf~~  377 (447)
T COG2907         301 LHTDASLMPRRLRAWASWNYLGTVQWELCQGSLTYWMNRLQALIS--V-RDYFVTLNNRPWVDPAHVIAERTYPHPLFDP  377 (447)
T ss_pred             EeecccccccccccccccceeccccccccCcceeccHHHhhcccC--C-cceEEEecCCcccChHHhhHHhhcCCcCCCH
Confidence            99999999999999999999874   3457799999999999987  4 78899999  777788889999999999999


Q ss_pred             hHHHHHHHHHhhcCCCCeEEeccccCCCCChhHHHHHHHHHHHhcCCcccccCCCCCCC
Q 036521          294 AASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMV  352 (602)
Q Consensus       294 ~~~~~~~~l~~lqg~~gl~~aG~~~g~g~~E~av~SG~~aA~~ll~~~~~~~~~~~~~~  352 (602)
                      ...++|+++.++||.+++||||+|+|.|||||+++||+.+|+++ |+.|+.....++++
T Consensus       378 ~avraqq~l~alqg~~~twfcgAy~g~GFHeDg~~aGl~va~~l-g~~w~~a~~sg~~~  435 (447)
T COG2907         378 EAVRAQQELWALQGARRTWFCGAYFGRGFHEDGLQAGLAVAEDL-GAPWEAAVPSGRAV  435 (447)
T ss_pred             HHHHHHHHHHhhhcCCCCCcchhhhccccchhhhhhHHHHHHhc-CCcccccCccchhh
Confidence            99999999999999999999999999999999999999999998 78777554444443



>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG5379 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase [Lipid metabolism] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PF02036 SCP2: SCP-2 sterol transfer family; InterPro: IPR003033 This domain is involved in binding sterols, and is found in proteins such as SCP2 Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
1tpy_A 287 Structure Of The Cyclopropane Synthase Mmaa2 From M 2e-15
1kpg_A 287 Crystal Structure Of Mycolic Acid Cyclopropane Synt 3e-15
1kp9_A 287 Crystal Structure Of Mycolic Acid Cyclopropane Synt 3e-15
1kpi_A 302 Crystal Structure Of Mycolic Acid Cyclopropane Synt 9e-15
1l1e_A 287 Crystal Structure Of Mycolic Acid Cyclopropane Synt 2e-14
2fk7_A 318 Crystal Structure Of Hma (Mmaa4) From Mycobacterium 8e-14
>pdb|1TPY|A Chain A, Structure Of The Cyclopropane Synthase Mmaa2 From Mycobacterium Tuberculosis Length = 287 Back     alignment and structure

Iteration: 1

Score = 80.9 bits (198), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 40/107 (37%), Positives = 58/107 (54%) Query: 489 NSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARV 548 N L ++ HYDLS++ F LF+D + TYSC F+ ED L+ AQ+ K L + K + Sbjct: 3 NDLTPHFEDVQAHYDLSDDFFRLFLDPTQTYSCAHFEREDMTLEEAQIAKIDLALGKLGL 62 Query: 549 SKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVNE 595 G +L+IGCGWG + Q N G+TLS Q + + +E Sbjct: 63 QPGMTLLDIGCGWGATMRRAIAQYDVNVVGLTLSKNQAAHVQKSFDE 109
>pdb|1KPG|A Chain A, Crystal Structure Of Mycolic Acid Cyclopropane Synthase Cmaa1 Complexed With Sah And Ctab Length = 287 Back     alignment and structure
>pdb|1KP9|A Chain A, Crystal Structure Of Mycolic Acid Cyclopropane Synthase Cmaa1, Apo-Form Length = 287 Back     alignment and structure
>pdb|1KPI|A Chain A, Crystal Structure Of Mycolic Acid Cyclopropane Synthase Cmaa2 Complexed With Sah And Dddmab Length = 302 Back     alignment and structure
>pdb|1L1E|A Chain A, Crystal Structure Of Mycolic Acid Cyclopropane Synthase Pcaa Complexed With S-Adenosyl-L-Homocysteine Length = 287 Back     alignment and structure
>pdb|2FK7|A Chain A, Crystal Structure Of Hma (Mmaa4) From Mycobacterium Tuberculosis, Apo- Form Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 2e-49
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 2e-46
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 8e-46
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 2e-39
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 6e-31
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 6e-26
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 3e-19
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 3e-18
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 6e-16
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 9e-12
3f4k_A 257 Putative methyltransferase; structural genomics, P 2e-10
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 2e-10
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 8e-09
3ocj_A 305 Putative exported protein; structural genomics, PS 2e-08
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 2e-08
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 3e-07
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 3e-06
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 4e-06
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 8e-06
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 8e-06
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 9e-06
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 9e-06
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 2e-05
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 2e-05
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 4e-05
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 4e-05
3cc8_A 230 Putative methyltransferase; structural genomics, j 6e-05
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 9e-05
2p7i_A 250 Hypothetical protein; putative methyltransferase, 1e-04
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 1e-04
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 1e-04
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 1e-04
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 1e-04
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 1e-04
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 2e-04
3i9f_A 170 Putative type 11 methyltransferase; structural gen 2e-04
3m70_A 286 Tellurite resistance protein TEHB homolog; structu 2e-04
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 2e-04
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 3e-04
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 4e-04
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 4e-04
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 4e-04
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 6e-04
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 7e-04
1xxl_A 239 YCGJ protein; structural genomics, protein structu 8e-04
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Length = 318 Back     alignment and structure
 Score =  173 bits (440), Expect = 2e-49
 Identities = 39/134 (29%), Positives = 59/134 (44%)

Query: 466 WTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFK 525
           +     +  +   S+                +I  HYD+S++ FALF D + TYSC  F+
Sbjct: 6   YHHHHSSGLVPRGSHMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFE 65

Query: 526 DEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQ 585
             +  L+ AQ  K  L ++K  +  G  +L+IGCGWGT     V +   N  G+TLS  Q
Sbjct: 66  PPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQ 125

Query: 586 LKYAEMKVNEAGLQ 599
               E  +      
Sbjct: 126 HARCEQVLASIDTN 139


>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Length = 287 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} PDB: 1kpi_A* Length = 302 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* Length = 312 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Length = 286 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.87
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.81
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.8
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.78
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.78
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.78
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.76
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.75
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.71
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.7
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.69
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.69
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.68
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.67
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.63
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.63
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 99.61
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.59
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.59
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.58
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.56
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 99.52
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.36
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.36
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.34
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.31
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.3
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.26
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.18
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 99.17
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.11
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.07
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.02
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.98
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.97
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.96
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 98.93
3dxy_A 218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.88
1zx0_A 236 Guanidinoacetate N-methyltransferase; structural g 98.87
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 98.87
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.86
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.84
1pjz_A 203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.84
3mti_A 185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.83
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 98.8
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.79
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 98.79
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 98.79
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 98.78
2h00_A 254 Methyltransferase 10 domain containing protein; st 98.78
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.77
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 98.77
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.73
3f4k_A 257 Putative methyltransferase; structural genomics, P 98.72
2esr_A177 Methyltransferase; structural genomics, hypothetic 98.72
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 98.7
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.69
3orh_A 236 Guanidinoacetate N-methyltransferase; structura ge 98.69
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.69
3gdh_A 241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.69
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.69
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.67
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 98.66
3evz_A 230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.66
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 98.65
1u2z_A 433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.65
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.65
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 98.64
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 98.63
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.63
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.63
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 98.63
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.62
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 98.62
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.62
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 98.62
3dr5_A 221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.61
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 98.61
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.61
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.6
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 98.6
1nv8_A 284 HEMK protein; class I adoMet-dependent methyltrans 98.6
2ex4_A 241 Adrenal gland protein AD-003; methyltransferase, s 98.6
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.6
3u81_A 221 Catechol O-methyltransferase; neurotransmitter deg 98.6
3p2e_A 225 16S rRNA methylase; methyltransferase, transferase 98.6
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 98.6
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 98.59
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.59
3h2b_A 203 SAM-dependent methyltransferase; alpha-beta protei 98.59
2gb4_A 252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.58
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 98.58
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.58
1xxl_A 239 YCGJ protein; structural genomics, protein structu 98.58
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.58
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.57
2xvm_A 199 Tellurite resistance protein TEHB; antibiotic resi 98.57
2fca_A 213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.57
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.57
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.57
3ege_A 261 Putative methyltransferase from antibiotic biosyn 98.57
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 98.57
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.57
3m70_A 286 Tellurite resistance protein TEHB homolog; structu 98.56
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.56
4df3_A 233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.56
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 98.56
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.56
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 98.55
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 98.55
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.55
1xdz_A 240 Methyltransferase GIDB; MCSG, protein structure in 98.55
3mb5_A 255 SAM-dependent methyltransferase; RNA methyltransfe 98.54
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 98.54
3lpm_A 259 Putative methyltransferase; structural genomics, p 98.54
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 98.53
3ntv_A 232 MW1564 protein; rossmann fold, putative methyltran 98.53
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.53
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 98.52
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 98.52
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 98.52
2igt_A 332 SAM dependent methyltransferase; alpha-beta sandwi 98.52
1xtp_A 254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.51
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.51
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 98.51
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 98.5
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 98.5
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 98.49
3duw_A 223 OMT, O-methyltransferase, putative; alternating of 98.49
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.49
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.49
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 98.48
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.48
3mq2_A 218 16S rRNA methyltransferase; methyltranferase, ribo 98.48
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.47
3g89_A 249 Ribosomal RNA small subunit methyltransferase G; 1 98.47
4dmg_A 393 Putative uncharacterized protein TTHA1493; rRNA, m 98.47
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.47
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 98.46
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.46
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 98.46
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.46
1fbn_A 230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.46
1yzh_A 214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.45
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.45
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.45
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.45
3ofk_A 216 Nodulation protein S; NODS, N-methyltransferase, S 98.45
3tr6_A 225 O-methyltransferase; cellular processes; HET: SAH; 98.44
2gpy_A 233 O-methyltransferase; structural genomics, PSI, pro 98.44
1wy7_A 207 Hypothetical protein PH1948; seven-stranded beta s 98.44
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 98.44
2frn_A 278 Hypothetical protein PH0793; structural genomics, 98.43
2yvl_A 248 TRMI protein, hypothetical protein; tRNA, methyltr 98.43
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.42
3ckk_A 235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.42
2b3t_A 276 Protein methyltransferase HEMK; translation termin 98.42
1o9g_A 250 RRNA methyltransferase; antibiotic resistance, Se- 98.42
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.42
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 98.41
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 98.41
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.41
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.41
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 98.41
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.4
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.4
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 98.4
3k6r_A 278 Putative transferase PH0793; structural genomics, 98.4
3lcc_A 235 Putative methyl chloride transferase; halide methy 98.39
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 98.39
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 98.38
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 98.38
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 98.38
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.37
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.37
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 98.36
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 98.35
2p7i_A 250 Hypothetical protein; putative methyltransferase, 98.35
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.35
2kw5_A 202 SLR1183 protein; structural genomics, northeast st 98.35
3tm4_A 373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.34
2pwy_A 258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.34
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.34
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 98.34
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.34
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 98.33
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.33
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.33
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.33
3ocj_A 305 Putative exported protein; structural genomics, PS 98.32
2ipx_A 233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.32
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.31
3i9f_A 170 Putative type 11 methyltransferase; structural gen 98.31
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 98.3
1sui_A 247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.3
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 98.3
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.3
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.3
2r6z_A 258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.29
2avd_A 229 Catechol-O-methyltransferase; structural genomics, 98.29
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.29
3bt7_A 369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.29
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.29
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.29
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.29
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.28
3id6_C 232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.28
2b25_A 336 Hypothetical protein; structural genomics, methyl 98.28
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 98.28
3r3h_A 242 O-methyltransferase, SAM-dependent; structural gen 98.27
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.27
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 98.27
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.27
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 98.26
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.26
3cbg_A 232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.25
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 98.25
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 98.25
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 98.24
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.24
3c3y_A 237 Pfomt, O-methyltransferase; plant secondary metabo 98.24
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.23
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.23
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.22
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.21
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 98.21
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.21
2b78_A 385 Hypothetical protein SMU.776; structure genomics, 98.18
2qe6_A 274 Uncharacterized protein TFU_2867; putative methylt 98.18
2pxx_A 215 Uncharacterized protein MGC2408; structural genomi 98.17
3c0k_A 396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.17
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.16
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 98.15
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.15
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 98.13
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.13
3giw_A 277 Protein of unknown function DUF574; rossmann-fold 98.13
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.11
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.11
2as0_A 396 Hypothetical protein PH1915; RNA methyltransferase 98.09
1wxx_A 382 TT1595, hypothetical protein TTHA1280; thermus the 98.09
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.08
3cc8_A 230 Putative methyltransferase; structural genomics, j 98.08
3dou_A 191 Ribosomal RNA large subunit methyltransferase J; c 98.08
3k0b_A 393 Predicted N6-adenine-specific DNA methylase; methy 98.05
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.05
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 98.04
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.04
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.04
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.03
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.03
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 98.03
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.01
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.01
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.0
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.0
2oyr_A 258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.0
2plw_A 201 Ribosomal RNA methyltransferase, putative; malaria 97.99
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.99
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 97.97
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 97.95
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.95
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 97.94
2zig_A297 TTHA0409, putative modification methylase; methylt 97.94
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 97.94
2o07_A 304 Spermidine synthase; structural genomics, structur 97.92
2nyu_A 196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.9
1sqg_A 429 SUN protein, FMU protein; rossmann-fold, mixed bet 97.9
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 97.86
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.86
1vg0_A650 RAB proteins geranylgeranyltransferase component A 97.86
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 97.86
2pt6_A 321 Spermidine synthase; transferase, structural genom 97.85
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 97.83
1vlm_A 219 SAM-dependent methyltransferase; possible histamin 97.83
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 97.83
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 97.83
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 97.82
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 97.79
1ej0_A 180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.77
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 97.74
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 97.73
1af7_A 274 Chemotaxis receptor methyltransferase CHER; chemot 97.73
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 97.73
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 97.72
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 97.72
2qm3_A 373 Predicted methyltransferase; putative methyltransf 97.71
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 97.71
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 97.68
2i7c_A 283 Spermidine synthase; transferase, structural genom 97.66
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 97.66
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.52
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 97.5
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 97.48
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 97.46
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 97.46
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.43
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 97.43
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 97.36
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.36
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 97.3
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.3
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.29
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 97.28
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 97.2
3sso_A 419 Methyltransferase; macrolide, natural product, ros 97.1
4a6d_A 353 Hydroxyindole O-methyltransferase; melatonin, circ 97.1
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.1
3khk_A 544 Type I restriction-modification system methylation 97.09
3p8z_A 267 Mtase, non-structural protein 5; methyltransferase 97.07
2qfm_A 364 Spermine synthase; spermidine aminopropyltransfera 97.03
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 97.02
3cvo_A 202 Methyltransferase-like protein of unknown functio; 96.97
3lkd_A 542 Type I restriction-modification system methyltrans 96.9
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 96.86
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 96.66
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 96.61
4auk_A 375 Ribosomal RNA large subunit methyltransferase M; Y 96.4
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 96.39
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 96.14
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 96.14
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 96.08
3ufb_A 530 Type I restriction-modification system methyltran 95.99
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 95.97
4fzv_A 359 Putative methyltransferase NSUN4; mterf fold, meth 95.92
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 95.75
2px2_A 269 Genome polyprotein [contains: capsid protein C (co 95.7
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 95.47
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 95.43
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 95.31
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 95.24
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 95.03
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 95.01
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 95.01
3dme_A369 Conserved exported protein; structural genomics, P 94.96
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 94.71
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.53
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 94.44
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 94.27
2gqf_A401 Hypothetical protein HI0933; structural genomics, 94.24
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.22
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 94.18
2ywl_A180 Thioredoxin reductase related protein; uncharacter 94.05
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.02
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 93.85
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 93.7
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 93.6
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 93.58
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 93.53
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 93.46
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 93.45
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 93.43
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.31
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 93.18
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 93.16
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 93.09
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 93.09
2qy6_A 257 UPF0209 protein YFCK; structural genomics, unknown 93.03
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 92.87
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 92.72
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 92.65
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 92.61
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 92.55
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 92.53
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 92.45
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 92.4
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 92.4
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 92.39
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 92.29
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 92.29
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 92.27
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 92.19
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 92.16
3gms_A 340 Putative NADPH:quinone reductase; structural genom 92.13
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 92.05
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 91.87
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 91.83
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 91.76
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 91.66
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 91.64
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 91.52
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 91.42
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 91.39
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 91.32
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 91.27
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 91.27
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 91.21
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 91.2
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 90.97
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 90.97
1fec_A490 Trypanothione reductase; redox-active center, oxid 90.82
3o4f_A 294 Spermidine synthase; aminopropyltransferase, polya 90.68
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 90.65
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 90.65
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 90.61
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 90.54
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 90.49
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 90.43
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 90.18
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 90.17
4dna_A463 Probable glutathione reductase; structural genomic 90.12
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 90.11
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 89.93
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 89.87
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 89.68
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 89.66
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 89.64
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 89.62
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 89.61
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 89.55
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 89.51
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 89.36
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 89.23
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 89.23
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 89.16
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 89.11
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 89.11
4eye_A 342 Probable oxidoreductase; structural genomics, niai 89.07
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 89.01
2cul_A232 Glucose-inhibited division protein A-related PROT 88.99
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 88.98
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 88.95
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 88.73
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 88.45
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 88.36
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 88.23
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 88.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 87.96
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 87.9
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 87.84
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 87.82
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 87.78
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 87.77
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 87.73
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 87.7
3c6k_A 381 Spermine synthase; spermidine aminopropyltransfera 87.69
1ojt_A482 Surface protein; redox-active center, glycolysis, 87.64
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 87.62
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 87.6
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 87.48
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 87.47
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 87.38
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 87.37
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 87.36
3cnu_A116 Predicted coding region AF_1534; structural GE MCS 87.29
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 87.2
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 87.16
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 87.14
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 87.13
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 87.11
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 87.06
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 86.94
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 86.88
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 86.87
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 86.79
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 86.74
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 86.25
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 86.02
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 85.99
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 85.97
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 85.85
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 85.63
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 85.62
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 85.61
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 85.57
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 85.51
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 85.09
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 84.91
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 84.88
3bkr_A126 Sterol carrier protein-2 like-3; mosquito, fatty a 84.67
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 84.64
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 84.63
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 84.61
3atr_A453 Conserved archaeal protein; saturating double bond 84.6
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 84.53
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 84.5
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 84.48
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 84.05
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 83.69
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 83.67
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 83.48
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 83.44
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 83.25
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 83.12
1ikt_A120 Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, 83.03
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 83.0
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 82.86
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 82.72
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 82.28
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 82.24
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 82.15
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 82.12
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 82.07
4hb9_A412 Similarities with probable monooxygenase; flavin, 82.07
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 81.77
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 81.75
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 81.73
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 81.52
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 81.32
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 81.13
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
Probab=99.87  E-value=3.7e-22  Score=213.94  Aligned_cols=261  Identities=13%  Similarity=0.120  Sum_probs=178.6

Q ss_pred             CCCCHHHHHHhcCCCHHHHHHHHHHHHhhhcCCChhhHHhhhHHHHHHHHHhcCccccCCCCcEEEecCCcHhHHHHHHH
Q 036521           63 RDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPSEGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIA  142 (602)
Q Consensus        63 ~~~s~~~~l~~~~~~~~~~~~~~~pl~~~v~~~~~~~~~~~p~~~~l~~~~~~g~~~~~~~~~~~~~~gG~~~l~~~la~  142 (602)
                      +.+|+.+|+++++++ .+.+.++.|++.++|+ ++   .++|+.++++++..++++....++.+ ++.+|+++++++|++
T Consensus       141 ~~~s~~~~l~~~~~~-~~~~~~~~~~~~~~~~-~~---~~~~a~~~~~~~~~~~~~~~~~~~~~-~~~~g~~~l~~~l~~  214 (424)
T 2b9w_A          141 LMLPFDEFLALNGCE-AARDLWINPFTAFGYG-HF---DNVPAAYVLKYLDFVTMMSFAKGDLW-TWADGTQAMFEHLNA  214 (424)
T ss_dssp             GGSBHHHHHHHTTCG-GGHHHHTTTTCCCCCC-CT---TTSBHHHHHHHSCHHHHHHHHHTCCB-CCTTCHHHHHHHHHH
T ss_pred             hccCHHHHHHhhCcH-HHHHHHHHHHHhhccC-Ch---HhcCHHHHHHhhhHhhhhcccCCceE-EeCChHHHHHHHHHH
Confidence            468999999998776 5778888898887775 33   34688777776654433322223444 689999999999999


Q ss_pred             HHhcCCCeEEeCCceeEEEecCCeEEEEeCCCcEEecCEEEEecChHHHHhhccCCCCHHHHhhccCccccceeEEEecC
Q 036521          143 LLESLGCQIKTGCEVCSVLQYDEGRTEVRGDGFQGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRD  222 (602)
Q Consensus       143 ~l~~~g~~v~l~t~V~~i~~~~~gv~v~~~~g~~~~ad~VI~A~p~~~a~~ll~~~~~~~~~~~l~~~~y~~~~~vl~~d  222 (602)
                      .+   +.+|+++++|++|.+++++|.|++.+| ++.||+||+|+|+.++.++++  +.+.+++.+++++|.+..+.+...
T Consensus       215 ~l---~~~v~~~~~V~~i~~~~~~v~v~~~~g-~~~ad~Vv~a~~~~~~~~~l~--~~~~~~~~~~~~~~~~~~~~~~~~  288 (424)
T 2b9w_A          215 TL---EHPAERNVDITRITREDGKVHIHTTDW-DRESDVLVLTVPLEKFLDYSD--ADDDEREYFSKIIHQQYMVDACLV  288 (424)
T ss_dssp             HS---SSCCBCSCCEEEEECCTTCEEEEESSC-EEEESEEEECSCHHHHTTSBC--CCHHHHHHHTTCEEEEEEEEEEEE
T ss_pred             hh---cceEEcCCEEEEEEEECCEEEEEECCC-eEEcCEEEECCCHHHHhhccC--CCHHHHHHHhcCCcceeEEEEEEe
Confidence            99   678999999999999888899988888 489999999999999988876  567777888999887754332221


Q ss_pred             CC------CCCCC----CCccccccccc-CC-CCCeEEEEeccccccCCCCCCCCCe-------EEEcCCCCCCcce-EE
Q 036521          223 KN------FMPRN----PAAWSAWNFLG-GL-DGKACLTYWLNVLQNIGDGETGLPF-------LVTLNPDHTPNNT-LL  282 (602)
Q Consensus       223 ~~------l~p~~----~~~w~s~n~~~-~~-~~~~~~t~~~~~~~~l~~~~~~~~v-------~~tl~p~~~p~~~-l~  282 (602)
                      ..      ++|.+    ...|..++... ++ +......|.++....+... ..+.+       ++++++. .++.+ ..
T Consensus       289 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~-~~~~~~~~v~~~l~~l~~~-~~~~~~~~  366 (424)
T 2b9w_A          289 KEYPTISGYVPDNMRPERLGHVMVYYHRWADDPHQIITTYLLRNHPDYADK-TQEECRQMVLDDMETFGHP-VEKIIEEQ  366 (424)
T ss_dssp             SSCCSSEEECGGGGSGGGTTSCCEEEECCTTCTTSCEEEEEECCBTTBCCC-CHHHHHHHHHHHHHHTTCC-EEEEEEEE
T ss_pred             ccCCcccccccCCCCCcCCCcceEEeeecCCCCceEEEEEeccCCCccccc-ChHHHHHHHHHHHHHcCCc-cccccccc
Confidence            11      22322    12233333322 22 2345566665543333221 10111       1234432 11111 23


Q ss_pred             EEEccCCCCChhHHHH--HHHHHhhcCCCCeEEeccccCCCCChhHHHHHHHHHHHhc
Q 036521          283 KWSTGHPVPSVAASKA--SLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVL  338 (602)
Q Consensus       283 r~~~~~p~~~~~~~~~--~~~l~~lqg~~gl~~aG~~~g~g~~E~av~SG~~aA~~ll  338 (602)
                      .|.. +|.+.......  ++++..+|+.++|||||+|+++|+||+|++||++||++|+
T Consensus       367 ~w~~-~p~~~~~~~~~G~~~~~~~~~~~~~l~~aG~~~~~g~~e~a~~Sg~~aA~~~l  423 (424)
T 2b9w_A          367 TWYY-FPHVSSEDYKAGWYEKVEGMQGRRNTFYAGEIMSFGNFDEVCHYSKDLVTRFF  423 (424)
T ss_dssp             EEEE-EEECCHHHHHTTHHHHHHHTTTGGGEEECSGGGSCSSHHHHHHHHHHHHHHHT
T ss_pred             ceee-eeccCHHHHhccHHHHHHHHhCCCCceEeccccccccHHHHHHHHHHHHHHhc
Confidence            5654 77777665554  6777888899999999999999999999999999999885



>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3cnu_A Predicted coding region AF_1534; structural GE MCSG, PSI-2, protein structure initiative, midwest center F structural genomics; 1.90A {Archaeoglobus fulgidus dsm 4304} PDB: 3bn8_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3bkr_A Sterol carrier protein-2 like-3; mosquito, fatty acid, palmitic acid, cholesterol, lipid binding protein; HET: PLM; 1.40A {Aedes aegypti} PDB: 3bks_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1ikt_A Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, protein-triton X-100 complex, hydrophobic tunnel; HET: OXN; 1.75A {Homo sapiens} SCOP: d.106.1.1 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 602
d1kpga_ 285 c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [ 6e-27
d1kpia_ 291 c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [ 7e-25
d2fk8a1 280 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 2e-23
d1nw3a_ 328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 2e-16
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 2e-08
d2a14a1 257 c.66.1.15 (A:5-261) Indolethylamine N-methyltransf 3e-08
d1u2za_ 406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 2e-07
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 2e-06
d1nkva_ 245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 1e-05
d2o57a1 282 c.66.1.18 (A:16-297) Putative sarcosine dimethylgl 1e-05
d1ri5a_ 252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 1e-05
d1vl5a_ 231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 5e-05
d1l3ia_ 186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 6e-05
d1xxla_ 234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 1e-04
d2fyta1 311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 2e-04
d1pjza_ 201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 0.001
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 0.002
d1xvaa_ 292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 0.002
d1g6q1_ 328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 0.002
d1zx0a1 229 c.66.1.16 (A:8-236) Guanidinoacetate methyltransfe 0.003
d1oria_ 316 c.66.1.6 (A:) Protein arginine N-methyltransferase 0.003
d1yb2a1 250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 0.003
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Mycolic acid cyclopropane synthase
domain: CmaA1
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score =  108 bits (270), Expect = 6e-27
 Identities = 38/106 (35%), Positives = 58/106 (54%)

Query: 489 NSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARV 548
           + L     N+  HYDLS++ F LF+D + TYSC  F+ +D  L+ AQ+ K  L + K  +
Sbjct: 1   DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGL 60

Query: 549 SKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMKVN 594
             G  +L++GCGWG   +  V +   N  G+TLS  Q  + +  V 
Sbjct: 61  QPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVA 106


>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291 Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Length = 282 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.95
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.94
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.94
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 99.58
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 99.53
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.29
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.2
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.19
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 99.16
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.16
d1l3ia_ 186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.13
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.12
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 99.11
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.03
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.02
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.99
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 98.91
d2ex4a1 222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.91
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 98.9
d1u2za_ 406 Catalytic, N-terminal domain of histone methyltran 98.9
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.89
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 98.87
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.87
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.86
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.86
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.84
d1o54a_ 266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.84
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.83
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 98.79
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.76
d1zx0a1 229 Guanidinoacetate methyltransferase {Human (Homo sa 98.73
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.71
d1g8sa_ 230 Fibrillarin homologue {Archaeon Methanococcus jann 98.7
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.67
d1xtpa_ 254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.66
d1i9ga_ 264 Probable methyltransferase Rv2118c {Mycobacterium 98.65
d1wy7a1 201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.61
d1vbfa_ 224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.57
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.56
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.55
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.55
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.53
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.49
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.46
d2frna1 260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.46
d1tw3a2 253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.44
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.42
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.39
d2fcaa1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.38
d2h00a1 250 Methyltransferase 10 domain containing protein MET 98.37
d2as0a2 324 Hypothetical protein PH1915, middle and C-terminal 98.33
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.31
d1yzha1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.29
d1m6ya2 192 TM0872, methyltransferase domain {Thermotoga marit 98.29
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.29
d1qzza2 256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.28
d2b3ta1 274 N5-glutamine methyltransferase, HemK {Escherichia 98.28
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.28
d2igta1 309 Putative methyltransferase Atu0340 {Agrobacterium 98.28
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.26
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.25
d1wxxa2 318 Hypothetical protein TTHA1280, middle and C-termin 98.24
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.24
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.23
d1vlma_ 208 Possible histamine N-methyltransferase TM1293 {The 98.23
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.21
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.12
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 98.11
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.02
d1nv8a_ 271 N5-glutamine methyltransferase, HemK {Thermotoga m 97.99
d2b78a2 317 Hypothetical protein SMu776, middle and C-terminal 97.96
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 97.83
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.83
d2cl5a1 214 Catechol O-methyltransferase, COMT {Rat (Rattus no 97.83
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 97.8
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 97.79
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 97.7
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.65
d2avda1 219 COMT domain-containing protein 1, COMTD1 {Human (H 97.57
d1wg8a2 182 TM0872, methyltransferase domain {Thermus thermoph 97.29
d1susa1 227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.23
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.16
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.07
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.06
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.04
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.78
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 96.76
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.71
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.7
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 96.69
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 96.59
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.55
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 96.51
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.5
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.43
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.38
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.34
d2b9ea1 293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.28
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 96.2
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 96.19
d2p41a1 257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.17
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.13
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.07
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.06
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.01
d1ej0a_ 180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 96.0
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 95.81
d1fp1d2 244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 95.8
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 95.69
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.62
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.59
d1ixka_ 313 Hypothetical methyltransferase PH1374 {Archaeon Py 95.59
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.58
d1sqga2 284 Ribosomal RNA small subunit methyltransferase B, R 95.56
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.53
d1kyza2 243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 95.51
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.48
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 95.41
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.38
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.35
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.34
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 95.34
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.29
d2oyra1 250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 95.29
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 95.25
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.24
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.13
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.09
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.02
d1af7a2 193 Chemotaxis receptor methyltransferase CheR, C-term 94.94
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 94.89
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.85
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 94.8
d1xdza_ 239 Glucose-inhibited division protein B (GidB) {Bacil 94.72
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.46
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 94.32
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.28
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 94.22
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.19
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.16
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 94.09
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.94
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.92
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.59
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 93.52
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.18
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.05
d1inla_ 295 Spermidine synthase {Thermotoga maritima [TaxId: 2 93.02
d1fp2a2 244 Isoflavone O-methyltransferase {Alfalfa (Medicago 92.92
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.92
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 92.44
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.25
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 91.54
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 91.05
d1pqwa_ 183 Putative enoyl reductase domain of polyketide synt 90.36
d1iy9a_ 274 Spermidine synthase {Bacillus subtilis [TaxId: 142 89.81
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 89.39
d2o07a1 285 Spermidine synthase {Human (Homo sapiens) [TaxId: 88.97
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 88.95
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 88.91
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 88.87
d2b2ca1 312 Spermidine synthase {Caenorhabditis elegans [TaxId 88.41
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 87.48
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 87.39
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.18
d1gu7a2 189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 87.05
d1ikta_115 SCP2-like domain of MFE-2 {Human (Homo sapiens) [T 86.57
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 86.06
d2py6a1 395 Methyltransferase FkbM {Methylobacillus flagellatu 85.81
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 85.61
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 85.58
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 84.39
d1o9ga_ 249 rRNA methyltransferase AviRa {Streptomyces viridoc 84.23
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 83.84
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 80.74
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Mycolic acid cyclopropane synthase
domain: CmaA1
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.95  E-value=3.1e-29  Score=250.43  Aligned_cols=113  Identities=34%  Similarity=0.604  Sum_probs=107.6

Q ss_pred             CchHHHHHhhHhhhccchHHHHhhcCCCCcccccccCCCCccHHHHHHHHHHHHHHHccCCCCCeEEEEecCchHHHHHH
Q 036521          489 NSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEV  568 (602)
Q Consensus       489 ~~~~~~~~~i~~~Yd~~~~~y~~~~~~~~~ys~~~~~~~~~~l~~aq~~~~~~l~~~l~l~~g~~vLDiGcG~G~~~~~l  568 (602)
                      |+.+.+.+||++|||++|+||++|||++|+||||||++++++|++||.+|++.++++++++||++|||||||||++++++
T Consensus         1 ~~~~~~~~~i~~HYD~~~~fy~~~Lg~~~~YS~g~~~~~~~tL~eAQ~~k~~~~~~~l~l~~G~~VLDiGCG~G~~a~~~   80 (285)
T d1kpga_           1 DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRA   80 (285)
T ss_dssp             CCSCCCHHHHHHHHTSCHHHHTTTSCTTCCCSCCCCSSTTCCHHHHHHHHHHHHHTTTTCCTTCEEEEETCTTSHHHHHH
T ss_pred             CCCCccHHHHHHhcCCcHHHHHHhCCCCCcEeeEEeCCCCCCHHHHHHHHHHHHHHHcCCCCCCEEEEecCcchHHHHHH
Confidence            34456788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhccCCEEEEEcCCHHHHHHHHHHHHHcCCCCC
Q 036521          569 VRQTGCNYTGITLSAEQLKYAEMKVNEAGLQVT  601 (602)
Q Consensus       569 a~~~g~~v~gid~S~~~l~~a~~~~~~~gl~~~  601 (602)
                      |+++||+|+|||+|++|+++|+++++++|+.++
T Consensus        81 a~~~g~~v~git~s~~Q~~~a~~~~~~~g~~~~  113 (285)
T d1kpga_          81 VEKYDVNVVGLTLSKNQANHVQQLVANSENLRS  113 (285)
T ss_dssp             HHHHCCEEEEEESCHHHHHHHHHHHHTCCCCSC
T ss_pred             HhcCCcceEEEeccHHHHHHHHHHHHhhhhhhh
Confidence            999999999999999999999999999998764



>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1ikta_ d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure