Citrus Sinensis ID: 036588


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-
NWNTSSSVCNWTGITCDVRTYRVTALNISGLNLTVTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSINFINNALFGELPPNFCNHLSNLESLFLKSNMFHGKIPSTLSSCKRLRETSLSLNDFFWDHTKRNWQQLYLSKNMFYGEIPSDIANCSYLRILVLQFNNFSGAIPKEISNLTKLEKLDLQYNKLQGTIPYAGHLYQLQWLDLSDNQLSGSLPSFKFKMPLLQFLDLSSNRLSAELPTNVFHNLPFLEELYLSNNMFYGEIPSDTANCSYLRILVLRFNNFSGAIPKEISNLTKLEKLDLQYNRLQGTILYVGHLLQLQWLDLSDNQLSGSLPSFKFNMPLLQFLDLSSNRLSVELPTNVFHNLPFLEELYLSNNMFYGEIPSDTQNCSYLRILVLKFNNFPGAIPKEISNLTKLEKLDLQYNRLQGTIPYAGHLFQLQWLDLSDNQLSGSLPSFKFKMPLLQFLDLSSNRLSTELPTNVFHNLPFLEELYLSNNMFYGEIPSDTPNCSYLRILVVQFNNFSGAIPKEI
cccccccccccccEEEccccccEEEEEEcccccCECccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccCCcccccccccccccccEEEccccccccccccccccEEEccccccECccccccccccccccEEcccccccccccHHcccccccccccccccccEECcccccccccccEEEcccccccccccHHccccccccEEccccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccCEECcccccccccccccEEEccccEEEEEcccccccccccEEcccccCCcccccccccccccccEEEccccCEEECccHHHHHccccccEEEccccCEECccccccccccccccEEcccccccccccHHccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEcccccccccccccccccccccEEEcccccccccccccc
NWNTSSSVCNWTGITCDVRTYRVTALNISGLNLTVTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSINFINNALFGELPPNFCNHLSNLESLFLKSNMFHGKIPSTLSSCKRLRETSLSLNDFFWDHTKRNWQQLYLSKNMFYGEIPSDIANCSYLRILVLQFNNFSGAIPKEISNLTKLEKLDLQYNKLQGTIPYAGHLYQLQWLDLSDNQLSGSLPSFKFKMPLLQFLDLSSNRLSAELPTNVFHNLPFLEELYLSNNMFYGEIPSDTANCSYLRILVLRFNNFSGAIPKEISNLTKLEKLDLQYNRLQGTILYVGHLLQLQWLDLSDNQLSGSLPSFKFNMPLLQFLDLSSNRLSVELPTNVFHNLPFLEELYLSNNMFYGEIPSDTQNCSYLRILVLKFNNFPGAIPKEISNLTKLEKLDLQYNRLQGTIPYAGHLFQLQWLDLSDNQLSGSLPSFKFKMPLLQFLDLSSNRLSTELPTNVFHNLPFLEELYLSNNMFYGEIPSDTPNCSYLRILVVQFNNFSGAIPKE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NWNTSSSVCNWTGITCDVRTYRVTALNISGLNLTVTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSINFINNALFGELPPNFCNHLSNLESLFLKSNMFHGKIPSTLSSCKRLRETSLSLNDFFWDHTKRNWQQLYLSKNMFYGEIPSDIANCSYLRILVLQFNNFSGAIPKEISNLTKLEKLDLQYNKLQGTIPYAGHLYQLQWLDLSDNQLSGSLPSFKFKMPLLQFLDLSSNRLSAELPTNVFHNLPFLEELYLSNNMFYGEIPSDTANCSYLRILVLRFNNFSGAIPKEISNLTKLEKLDLQYNRLQGTILYVGHLLQLQWLDLSDNQLSGSLPSFKFNMPLLQFLDLSSNRLSVELPTNVFHNLPFLEELYLSNNMFYGEIPSDTQNCSYLRILVLKFNNFPGAIPKEISNLTKLEKLDLQYNRLQGTIPYAGHLFQLQWLDLSDNQLSGSLPSFKFKMPLLQFLDLSSNRLSTELPTNVFHNLPFLEELYLSNNMFYGEIPSDTPNCSYLRILVVQFNNFSGAIPKEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 1-122,142-292
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 45-122,142-316
View the alignment between query and template
View the model in PyMOL
Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 8-124,144-444,469-536
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 1-540
View the alignment between query and template
View the model in PyMOL