Citrus Sinensis ID: 036602


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
VFLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRASIGASVLLQFEGIDFVDYDNAKHFKTSSSSTGSFFNSVTSKQMVKKDKNFLIPVSVCIVS
cHHHHHHHccccccccHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHcccccccccccccccccccccccccccccccccccEEccccccccccccccc
cHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHcccccccEccccccccEEEcccccccccccccHHHHHcccccccccEEEEEc
VFLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLnlngkkqptMKEVAFELAGIRASIGASVLLQFegidfvdydnakhfktsssstgsffnsvtskqmvkkdknflipVSVCIVS
vflkvinenrlfevldaqvlreaekEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRASIGASVLLQFEGIDFVDYDNAKHfktsssstgsffNSVTSkqmvkkdknflipvsvcivs
VFLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRASIGASVLLQFEGIDFVDYDNAKHfktsssstgsffnsvtsKQMVKKDKNFLIPVSVCIVS
*FLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRASIGASVLLQFEGIDFVDYDNAKHF*******************VKKDKNFLIPVSVCIV*
VFLKV**ENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNL*GK*QPTMKEVAFELAG*******************************************************PVSVCIVS
VFLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRASIGASVLLQFEGIDFVDYDNAKHFKTSSSSTGSFFNSVTSKQMVKKDKNFLIPVSVCIVS
VFLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRASIGASVLLQFEGIDFVDYDNAKHFKTSSSSTGSFFNSVTSKQMVKKDKNFLIPVSVCIVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VFLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRASIGASVLLQFEGIDFVDYDNAKHFKTSSSSTGSFFNSVTSKQMVKKDKNFLIPVSVCIVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
Q7X8C5748 Wall-associated receptor yes no 0.504 0.081 0.393 1e-08
Q9S9M2761 Wall-associated receptor no no 0.504 0.080 0.409 2e-08
Q9SA25720 Wall-associated receptor no no 0.454 0.076 0.436 3e-08
Q9C9L5792 Wall-associated receptor no no 0.520 0.079 0.396 9e-08
Q8RY17751 Wall-associated receptor no no 0.504 0.081 0.377 1e-07
Q9LN59788 Putative wall-associated no no 0.628 0.096 0.389 5e-07
Q9LMN6738 Wall-associated receptor no no 0.504 0.082 0.393 2e-06
Q9LMN7733 Wall-associated receptor no no 0.487 0.080 0.389 2e-06
Q9S9M3730 Wall-associated receptor no no 0.487 0.080 0.377 2e-06
Q8VYA3769 Wall-associated receptor no no 0.495 0.078 0.35 3e-06
>sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1 Back     alignment and function desciption
 Score = 58.5 bits (140), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 44/61 (72%)

Query: 2   FLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRA 61
           F++ + ENR+ +++D ++  E   ++V+++A +A+R LN  GKK+P M+EV+ EL  IR+
Sbjct: 632 FVEAVKENRVLDIVDDRIKDECNMDQVMSVANLARRCLNRKGKKRPNMREVSIELEMIRS 691

Query: 62  S 62
           S
Sbjct: 692 S 692




Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=Arabidopsis thaliana GN=WAKL4 PE=2 SV=2 Back     alignment and function description
>sp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana GN=WAKL8 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9L5|WAKLH_ARATH Wall-associated receptor kinase-like 9 OS=Arabidopsis thaliana GN=WAKL9 PE=2 SV=1 Back     alignment and function description
>sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN59|WAKLK_ARATH Putative wall-associated receptor kinase-like 11 OS=Arabidopsis thaliana GN=WAKL11 PE=3 SV=2 Back     alignment and function description
>sp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 4 OS=Arabidopsis thaliana GN=WAK4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 5 OS=Arabidopsis thaliana GN=WAK5 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 3 OS=Arabidopsis thaliana GN=WAKL3 PE=2 SV=2 Back     alignment and function description
>sp|Q8VYA3|WAKLJ_ARATH Wall-associated receptor kinase-like 10 OS=Arabidopsis thaliana GN=WAKL10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
255545824 727 kinase, putative [Ricinus communis] gi|2 0.809 0.134 0.524 3e-19
147852023 413 hypothetical protein VITISV_028337 [Viti 0.834 0.244 0.443 8e-14
255545828 694 kinase, putative [Ricinus communis] gi|2 0.520 0.090 0.587 2e-13
359491507 518 PREDICTED: wall-associated receptor kina 0.768 0.179 0.430 1e-12
147816247 705 hypothetical protein VITISV_007799 [Viti 0.768 0.131 0.430 1e-12
255541802 743 kinase, putative [Ricinus communis] gi|2 0.504 0.082 0.573 1e-12
147765961 679 hypothetical protein VITISV_007744 [Viti 0.826 0.147 0.435 2e-12
356532372 740 PREDICTED: wall-associated receptor kina 0.776 0.127 0.39 2e-12
356532451 712 PREDICTED: wall-associated receptor kina 0.487 0.082 0.542 7e-12
359475622 867 PREDICTED: wall-associated receptor kina 0.925 0.129 0.396 1e-11
>gi|255545824|ref|XP_002513972.1| kinase, putative [Ricinus communis] gi|223547058|gb|EEF48555.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 99.0 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 53/101 (52%), Positives = 71/101 (70%), Gaps = 3/101 (2%)

Query: 2   FLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRA 61
           FL  + ENRLFE+LDA+VL+E  +EE+I +A +A++ LNLNGKK+P MK VA EL GIR+
Sbjct: 611 FLMTMEENRLFEILDARVLKEGGREEIIAMAKMAEKCLNLNGKKRPKMKTVAIELEGIRS 670

Query: 62  SIGASVLLQ--FEGIDFVDYDNAKHFKTSSSSTGSFFNSVT 100
           S G S  +Q  +E +D+V  D    +  +SSSTGS  NS T
Sbjct: 671 SQGVSSTIQQDYEEVDYVVGDYTASWDVASSSTGS-LNSTT 710




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147852023|emb|CAN82287.1| hypothetical protein VITISV_028337 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545828|ref|XP_002513974.1| kinase, putative [Ricinus communis] gi|223547060|gb|EEF48557.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359491507|ref|XP_003634286.1| PREDICTED: wall-associated receptor kinase-like 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147816247|emb|CAN64181.1| hypothetical protein VITISV_007799 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255541802|ref|XP_002511965.1| kinase, putative [Ricinus communis] gi|223549145|gb|EEF50634.1| kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147765961|emb|CAN70207.1| hypothetical protein VITISV_007744 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532372|ref|XP_003534747.1| PREDICTED: wall-associated receptor kinase-like 22-like [Glycine max] Back     alignment and taxonomy information
>gi|356532451|ref|XP_003534786.1| PREDICTED: wall-associated receptor kinase-like 22-like [Glycine max] Back     alignment and taxonomy information
>gi|359475622|ref|XP_003631717.1| PREDICTED: wall-associated receptor kinase-like 10-like, partial [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
TAIR|locus:2200552730 WAKL1 "wall associated kinase- 0.504 0.083 0.409 6e-08
TAIR|locus:2200562748 WAKL2 "wall associated kinase- 0.504 0.081 0.393 6.2e-08
TAIR|locus:2032875720 AT1G16260 [Arabidopsis thalian 0.454 0.076 0.436 7.5e-08
TAIR|locus:2205040792 AT1G69730 [Arabidopsis thalian 0.520 0.079 0.396 2.3e-07
TAIR|locus:2019893751 RFO1 "RESISTANCE TO FUSARIUM O 0.504 0.081 0.377 4.5e-07
TAIR|locus:504956303166 AT1G21245 [Arabidopsis thalian 0.454 0.331 0.454 4.8e-07
TAIR|locus:2016377788 AT1G19390 [Arabidopsis thalian 0.628 0.096 0.389 6.1e-07
TAIR|locus:2014962733 WAK5 "wall associated kinase 5 0.487 0.080 0.389 4e-06
TAIR|locus:2014952738 WAK4 "wall associated kinase 4 0.504 0.082 0.393 5.1e-06
TAIR|locus:2094468433 AT3G25490 [Arabidopsis thalian 0.495 0.138 0.433 6.5e-06
TAIR|locus:2200552 WAKL1 "wall associated kinase-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 135 (52.6 bits), Expect = 6.0e-08, P = 6.0e-08
 Identities = 25/61 (40%), Positives = 44/61 (72%)

Query:     2 FLKVINENRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRA 61
             FL+ + ENR+ +++D ++  E++ E+V+ +A +A++ LN  GK +P MKEV+ EL  IR+
Sbjct:   645 FLEAMKENRVIDIIDIRIKDESKLEQVMAVAKLARKCLNRKGKNRPNMKEVSNELERIRS 704

Query:    62 S 62
             S
Sbjct:   705 S 705




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005618 "cell wall" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2200562 WAKL2 "wall associated kinase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032875 AT1G16260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205040 AT1G69730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019893 RFO1 "RESISTANCE TO FUSARIUM OXYSPORUM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956303 AT1G21245 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016377 AT1G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014962 WAK5 "wall associated kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014952 WAK4 "wall associated kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094468 AT3G25490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
KOG1187361 consensus Serine/threonine protein kinase [Signal 98.74
PLN00113968 leucine-rich repeat receptor-like protein kinase; 97.25
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 95.92
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 95.34
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 95.24
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 95.16
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 95.15
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 95.05
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 95.04
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 95.02
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 95.01
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 94.86
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 94.84
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 94.8
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 94.72
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 94.65
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 94.64
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 94.63
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 94.56
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 94.53
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 94.51
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 94.42
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 94.36
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 94.35
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 94.31
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 94.3
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 94.25
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 94.23
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 94.2
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 94.2
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 94.17
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 94.16
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 94.11
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 94.09
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 94.09
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 94.07
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 94.05
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 93.99
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 93.97
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 93.85
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 93.84
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 93.81
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 93.74
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 93.74
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 93.64
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 93.61
PHA02988283 hypothetical protein; Provisional 93.6
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 93.59
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 93.58
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 93.44
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 93.42
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 93.42
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 93.33
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 93.24
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 93.23
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 93.18
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 93.08
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 93.01
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 92.86
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 92.85
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 92.75
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 92.73
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 92.73
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 92.71
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 92.64
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 92.57
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 92.56
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 92.55
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 92.47
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 92.47
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 92.41
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 92.35
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 92.26
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 92.22
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 92.21
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 92.2
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 92.11
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 92.07
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 91.94
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 91.68
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 91.6
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 91.47
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 91.36
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 91.34
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 91.23
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 91.1
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 91.05
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 91.04
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 90.93
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 90.93
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 90.67
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 89.92
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 89.37
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 88.81
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 88.22
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 88.22
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 88.14
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 88.02
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 87.97
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 87.62
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 87.56
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 86.87
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 86.83
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 86.57
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 86.25
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 86.22
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 86.18
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 86.14
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 86.02
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 85.83
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 85.56
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 85.49
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 85.32
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 84.88
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 84.83
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 84.03
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 84.01
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 83.77
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 83.77
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 83.75
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 83.54
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 83.41
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 83.34
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 83.25
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 83.1
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 83.05
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 82.78
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 82.77
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 82.72
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 82.71
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 82.67
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 82.53
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 82.52
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 81.99
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 81.94
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 81.79
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 81.76
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 81.58
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 81.57
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 81.3
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 81.13
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 81.11
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 80.77
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 80.74
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 80.58
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 80.4
KOG1989 738 consensus ARK protein kinase family [Signal transd 80.19
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 80.14
PLN00009294 cyclin-dependent kinase A; Provisional 80.09
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 80.05
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=98.74  E-value=1.3e-08  Score=79.90  Aligned_cols=60  Identities=33%  Similarity=0.429  Sum_probs=52.3

Q ss_pred             ChhhhhhcCCccceeccccc-ccccH-HHHHHHHHHHhhhcCcCCCCCCCHHHHHHHHHhhh
Q 036602            1 VFLKVINENRLFEVLDAQVL-REAEK-EEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGIR   60 (121)
Q Consensus         1 ~~~~~~~~~~~~eilD~~l~-~~~~~-e~l~~v~~lAl~C~~~~~~~RP~M~eV~~~L~~i~   60 (121)
                      |++..+.++++.+++|++|. +.+.. +++.+++.+|++|++.++.+||+|.+|+.+|+.+.
T Consensus       292 w~~~~~~~~~~~eiiD~~l~~~~~~~~~~~~~~~~~a~~C~~~~~~~RP~m~~Vv~~L~~~~  353 (361)
T KOG1187|consen  292 WAKPLLEEGKLREIVDPRLKEGEYPDEKEVKKLAELALRCLRPDPKERPTMSQVVKELEGIL  353 (361)
T ss_pred             HHHHHHHCcchhheeCCCccCCCCChHHHHHHHHHHHHHHcCcCCCcCcCHHHHHHHHHhhc
Confidence            56778888899999999997 55554 79999999999999999999999999999996554



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 97.35
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 97.29
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 96.83
4aoj_A329 High affinity nerve growth factor receptor; transf 96.44
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 96.16
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 96.09
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 96.04
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 95.77
3soc_A322 Activin receptor type-2A; structural genomics cons 95.72
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 95.63
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 95.59
3q4u_A301 Activin receptor type-1; structural genomics conso 95.42
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 95.42
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 95.31
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 95.04
4ase_A353 Vascular endothelial growth factor receptor 2; tra 94.86
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 94.77
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 94.75
3poz_A327 Epidermal growth factor receptor; kinase domain, a 94.72
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 94.7
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 94.68
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 94.59
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 94.57
3lzb_A327 Epidermal growth factor receptor; epidermal growth 94.57
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 94.51
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 94.47
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 94.46
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 94.43
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 94.41
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 94.41
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 94.35
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 94.27
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 94.15
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 94.12
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 94.09
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 94.08
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 94.06
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 94.04
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 94.03
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 94.01
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 93.91
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 93.87
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 93.86
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 93.83
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 93.82
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 93.81
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 93.77
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 93.75
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 93.74
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 93.72
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 93.71
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 93.67
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 93.63
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 93.63
3pls_A298 Macrophage-stimulating protein receptor; protein k 93.59
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 93.58
2xir_A316 Vascular endothelial growth factor receptor 2; ang 93.33
2a19_B284 Interferon-induced, double-stranded RNA-activated 93.32
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 93.28
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 93.28
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 93.25
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 93.22
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 93.09
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 93.08
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 93.07
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 92.97
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 92.9
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 92.85
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 92.85
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 92.72
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 92.59
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 92.52
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 92.5
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 92.42
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 92.4
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 92.27
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 92.19
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 92.17
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 92.16
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 91.92
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 91.81
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 91.81
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 90.92
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 90.55
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 89.95
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 89.75
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 89.54
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 87.69
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 86.43
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 85.73
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 85.58
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 85.37
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 85.24
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 85.15
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 84.93
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 84.92
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 84.9
3fme_A290 Dual specificity mitogen-activated protein kinase; 84.71
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 84.67
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 84.43
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 84.37
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 83.98
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 83.63
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 83.57
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 83.5
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 83.39
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 83.33
3bhy_A283 Death-associated protein kinase 3; death associate 83.24
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 83.21
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 83.15
3aln_A327 Dual specificity mitogen-activated protein kinase; 83.12
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 82.92
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 82.9
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 82.51
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 82.5
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 82.36
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 82.35
2eue_A275 Carbon catabolite derepressing protein kinase; kin 82.34
2dyl_A318 Dual specificity mitogen-activated protein kinase 82.12
3an0_A340 Dual specificity mitogen-activated protein kinase; 81.98
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 81.73
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 81.7
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 81.7
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 81.62
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 81.58
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 81.53
3uqc_A286 Probable conserved transmembrane protein; structur 81.24
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 80.95
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 80.81
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 80.74
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 80.67
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 80.58
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 80.51
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 80.1
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 80.09
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 80.04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
Probab=97.35  E-value=0.00021  Score=52.58  Aligned_cols=51  Identities=25%  Similarity=0.270  Sum_probs=42.2

Q ss_pred             CCccceecccccccccHHHHHHHHHHHhhhcCcCCCCCCCHHHHHHHHHhh
Q 036602            9 NRLFEVLDAQVLREAEKEEVITIAMVAKRYLNLNGKKQPTMKEVAFELAGI   59 (121)
Q Consensus         9 ~~~~eilD~~l~~~~~~e~l~~v~~lAl~C~~~~~~~RP~M~eV~~~L~~i   59 (121)
                      .....+++..+......+....+..+...|++.+|.+||++.++++.|+..
T Consensus       259 ~~~~~~~~~~~~~~~~~~~~~~l~~li~~cl~~dP~~Rps~~ell~~L~~~  309 (326)
T 3uim_A          259 KKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGD  309 (326)
T ss_dssp             CCSTTSSCTTCTTSCCHHHHHHHHHHHHHHTCSCGGGSCCHHHHHHHHHTS
T ss_pred             hhhhhhcChhhccccCHHHHHHHHHHHHHHhCcCCccCCCHHHHHHHhcCc
Confidence            344566666666566777888999999999999999999999999999864



>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 96.72
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 96.59
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 96.55
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 96.34
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 96.32
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 96.22
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 96.12
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 96.08
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 96.08
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 96.04
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 95.94
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 95.81
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 95.75
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 95.65
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 95.63
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 95.39
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 95.09
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 94.87
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 94.84
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 94.77
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 94.73
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 94.58
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 94.32
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 87.65
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 84.86
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 83.09
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 82.43
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 81.24
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 80.53
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 80.01
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.72  E-value=0.0006  Score=47.86  Aligned_cols=33  Identities=12%  Similarity=0.203  Sum_probs=29.1

Q ss_pred             HHHHHHHhhhcCcCCCCCCCHHHHHHHHHhhhh
Q 036602           29 ITIAMVAKRYLNLNGKKQPTMKEVAFELAGIRA   61 (121)
Q Consensus        29 ~~v~~lAl~C~~~~~~~RP~M~eV~~~L~~i~~   61 (121)
                      ..+..+...|++.+|.+||+|.++++.|+.+..
T Consensus       229 ~~l~~li~~cl~~~p~~Rps~~~il~~L~~i~e  261 (263)
T d1sm2a_         229 THVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE  261 (263)
T ss_dssp             HHHHHHHHHHTCSSGGGSCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHccCCHhHCcCHHHHHHHHHHHHh
Confidence            356678899999999999999999999998864



>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure