Citrus Sinensis ID: 036691


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MKVKKSEPIKNLKAMIHVKEGISEDICDLFFAGDRLEAGRLVDYGIRNNSTLHFLHQNLSEMKLFVKIPTNQTATVVEAMPYHTVQNIKTMIQVKEGIQSDQFTLVYDGKLLKEDTATMTSMNIKSESIIHLVFCPKEILSIFVKAATGEIVNLEVKHSFAIRDVKAIVGSVVGVSAADHIMIYEGKKLEDSKTLAFYDMKDECLLEMFPSSIQIFVRTPIEEIVRLEVEVLIVVRDVKEIVANIIDLSLGNQDLFYAGTKLEACKTLASYGIKNNYVLDVLPSPFQIFVKTWGGKTITLDVQPYNTVQDVKVKLFDKLQTPLHLQSIVFAGKRLFENHVLARYNIQKHSTLHMVLAPSSRIIELPLIFIDPSISLSISISEVKEMAKVKFQAAVKELLVDQVALQDDRTLADYGMDLSEKVVLVF
ccccccccHHHHHHHHHHHccccccccEEEEccEEcccccccccccccccEEEEEEEcccccEEEEEEccccccEEccccccccHHHHHHHcHHHcccccccCEEEEcccccccccccccccccccccEEEEEEcccccEEEEEEcccccEEEEEcccccHHHHHHHHHHHccccccccEEEEEccEEcccccccccccccccccccccccccEEEEEcccccEEEEccccccHHHHHHHHHHcHHccccccccEEccccccccccccccccCCccCEEEccccccEEEEEEcccCEEEEccccccHHHHHHHHHHHHcccccccEEEEEccEEccccccccccccccccEEEEEEccccccccccEEEccccccccccHHHHHHHHHccccccEEEEEEccEEccccccHHccccccccEEEEEc
MKVKKSEPIKNLKAMIHVKEGISEDICDLFFAGDRLEAGRLVDYGIRNNSTLHFLHQNLSEMKLFVKIPTNQTATVVEAMPYHTVQNIKTMIQVKEGIQSDQFTLVYDGKLLKEDTATMTSMNIKSESIIHLVFCPKEILSIFVKAATGEIVNLEVKHSFAIRDVKAIVGSVVGVSAADHIMIYEGKKLEDSKTLAFYDMKDECLLEMFPSSIQIFVRTPIEEIVRLEVEVLIVVRDVKEIVANIIDLSLGNQDLFYAGTKLEACKTLASYGIKNNYVLDVLPSPFQIFVKTWGGKTITLDVQPYNTVQDVKVKLFDKLQTPLHLQSIVFAGKRLFENHVLARYNIQKHSTLHMVLAPSSRIIELPLIFIDPSISLSISISEVKEMAKVKFQAAVKELLVDQVALQDDRTLADYGMDLSEKVVLVF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVKKSEPIKNLKAMIHVKEGISEDICDLFFAGDRLEAGRLVDYGIRNNSTLHFLHQNLSEMKLFVKIPTNQTATVVEAMPYHTVQNIKTMIQVKEGIQSDQFTLVYDGKLLKEDTATMTSMNIKSESIIHLVFCPKEILSIFVKAATGEIVNLEVKHSFAIRDVKAIVGSVVGVSAADHIMIYEGKKLEDSKTLAFYDMKDECLLEMFPSSIQIFVRTPIEEIVRLEVEVLIVVRDVKEIVANIIDLSLGNQDLFYAGTKLEACKTLASYGIKNNYVLDVLPSPFQIFVKTWGGKTITLDVQPYNTVQDVKVKLFDKLQTPLHLQSIVFAGKRLFENHVLARYNIQKHSTLHMVLAPSSRIIELPLIFIDPSISLSISISEVKEMAKVKFQAAVKELLVDQVALQDDRTLADYGMDLSEKVVLVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyubiquitin Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, and DNA-damage responses. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.probableP0CG63
Polyubiquitin Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, and DNA-damage responses. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.probableP0CG72
Polyubiquitin Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, and DNA-damage responses. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.probableP0CG75

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B08, chain A
Confidence level:very confident
Coverage over the Query: 213-360
View the alignment between query and template
View the model in PyMOL
Template: 3U30, chain A
Confidence level:very confident
Coverage over the Query: 60-209
View the alignment between query and template
View the model in PyMOL
Template: 3U5E, chain m
Confidence level:very confident
Coverage over the Query: 362-394
View the alignment between query and template
View the model in PyMOL
Template: 2ZVN, chain A
Confidence level:confident
Coverage over the Query: 1-134
View the alignment between query and template
View the model in PyMOL
Template: 2ZVN, chain A
Confidence level:probable
Coverage over the Query: 1-134
View the alignment between query and template
View the model in PyMOL