Citrus Sinensis ID: 036805

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYPGGICL
cHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccccccccccccccccEEccEEEccccEEEEEEEEEcccccccccccccccccccc
cHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHccccccccccccccccEEEccEEcccccEEEEEEEEEccccccccccHHcccccEcc
TMVWSMTYLMNNPRAMKKVQMEIRSLiggnkgfvnendVQELHYLKAVVKETIrlqptesllppretiENCIIEWYEIQAKTHVFVIRWAigrdpetwqnpeevypggicl
TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETirlqptesllppreTIENCIIEWYEIQAKTHVFVIRWAIGrdpetwqnpeevypggicl
TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYPGGICL
***WSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQ************
TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYPGGICL
TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYPGGICL
TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYPGGICL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYPGGICL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q9LTL2501 Cytochrome P450 71B25 OS= yes no 0.954 0.211 0.547 5e-28
O65786504 Cytochrome P450 71B4 OS=A no no 0.954 0.210 0.514 3e-26
Q9LTL8498 Cytochrome P450 71B24 OS= no no 0.954 0.212 0.532 3e-26
Q9SAE3490 Cytochrome P450 71B28 OS= no no 0.954 0.216 0.490 4e-26
P24465502 Cytochrome P450 71A1 OS=P N/A no 0.945 0.209 0.481 4e-26
Q9LW27490 Bifunctional dihydrocamal no no 0.936 0.212 0.5 5e-26
Q9LIP3500 Cytochrome P450 71B37 OS= no no 0.945 0.21 0.547 6e-26
Q9LTM0501 Cytochrome P450 71B23 OS= no no 0.954 0.211 0.481 7e-26
O48958531 4-hydroxyphenylacetaldehy N/A no 0.954 0.199 0.471 2e-25
Q9LIP4500 Cytochrome P450 71B36 OS= no no 0.945 0.21 0.509 3e-25
>sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 Back     alignment and function desciption
 Score =  122 bits (307), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 58/106 (54%), Positives = 74/106 (69%)

Query: 1   TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTES 60
           TM+W+M  L+NNPR MKKVQ EIRS IG  K  + E DV +L YLK V+KET+RL P   
Sbjct: 313 TMIWAMAELVNNPRVMKKVQDEIRSCIGIKKERIEEEDVGKLQYLKLVIKETLRLHPAAP 372

Query: 61  LLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYP 106
           LL PRET+ +  I+ Y+I  KT + V  W++GRDP+ W+NPEE  P
Sbjct: 373 LLLPRETMADIKIQGYDIPRKTLLLVSAWSLGRDPKYWKNPEEFNP 418

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 Back     alignment and function description
>sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 Back     alignment and function description
>sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 Back     alignment and function description
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description
>sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 Back     alignment and function description
>sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
357016484209 putative cytochrome P450 [Citrus sinensi 0.954 0.507 0.726 7e-38
224062037 513 cytochrome P450 [Populus trichocarpa] gi 0.945 0.204 0.641 3e-34
224062041 513 cytochrome P450 [Populus trichocarpa] gi 0.945 0.204 0.641 3e-34
225458055 495 PREDICTED: cytochrome P450 83B1 [Vitis v 0.945 0.212 0.632 2e-33
357438237 591 Cytochrome P450 [Medicago truncatula] gi 0.936 0.175 0.657 2e-33
225458059 496 PREDICTED: cytochrome P450 83B1-like [Vi 0.945 0.211 0.641 5e-33
225458053 498 PREDICTED: cytochrome P450 83B1 [Vitis v 0.945 0.210 0.613 3e-31
302142620 912 unnamed protein product [Vitis vinifera] 0.945 0.115 0.613 3e-31
225458057 494 PREDICTED: cytochrome P450 71A1 [Vitis v 0.945 0.212 0.632 7e-31
225458049 496 PREDICTED: cytochrome P450 83B1 [Vitis v 0.945 0.211 0.603 1e-30
>gi|357016484|gb|AET50435.1| putative cytochrome P450 [Citrus sinensis] Back     alignment and taxonomy information
 Score =  160 bits (406), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 87/106 (82%)

Query: 1   TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTES 60
           TMVW+MTYLM +PR MKKVQ EIRSL+GGNK FV+E+DVQELHYLKAVVKE +RLQP   
Sbjct: 13  TMVWTMTYLMMHPRVMKKVQEEIRSLVGGNKSFVDEDDVQELHYLKAVVKEAMRLQPPVP 72

Query: 61  LLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYP 106
           LL PRET E CI++ YEI AKT V+V  WAIGRDPE W+NPEE  P
Sbjct: 73  LLVPRETTEKCIVDGYEIPAKTIVYVNAWAIGRDPEAWENPEEFNP 118

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224062037|ref|XP_002300723.1| cytochrome P450 [Populus trichocarpa] gi|222842449|gb|EEE79996.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224062041|ref|XP_002300725.1| cytochrome P450 [Populus trichocarpa] gi|222842451|gb|EEE79998.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458055|ref|XP_002278300.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357438237|ref|XP_003589394.1| Cytochrome P450 [Medicago truncatula] gi|355478442|gb|AES59645.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|225458059|ref|XP_002278372.1| PREDICTED: cytochrome P450 83B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458053|ref|XP_002280472.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] gi|147832399|emb|CAN64422.1| hypothetical protein VITISV_032274 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142620|emb|CBI19823.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458057|ref|XP_002278387.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458049|ref|XP_002280438.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
TAIR|locus:2093526501 CYP71B25 ""cytochrome P450, fa 0.954 0.211 0.547 4.3e-26
TAIR|locus:2079316500 CYP71B37 ""cytochrome P450, fa 0.945 0.21 0.547 1.2e-25
TAIR|locus:2031915490 CYP71B28 ""cytochrome P450, fa 0.954 0.216 0.490 2.4e-24
TAIR|locus:2093546501 CYP71B3 ""cytochrome P450, fam 0.954 0.211 0.523 2.7e-24
TAIR|locus:2093556498 CYP71B24 ""cytochrome P450, fa 0.954 0.212 0.532 3.3e-24
TAIR|locus:2088394490 PAD3 "PHYTOALEXIN DEFICIENT 3" 0.936 0.212 0.5 4e-24
TAIR|locus:2093536504 CYP71B4 ""cytochrome P450, fam 0.954 0.210 0.514 4.5e-24
TAIR|locus:2079311500 CYP71B36 ""cytochrome P450, fa 0.945 0.21 0.509 5.7e-24
TAIR|locus:2093531501 CYP71B23 ""cytochrome P450, fa 0.954 0.211 0.481 9.5e-24
TAIR|locus:2093541499 CYP71B21 ""cytochrome P450, fa 0.954 0.212 0.481 1.2e-23
TAIR|locus:2093526 CYP71B25 ""cytochrome P450, family 71, subfamily B, polypeptide 25"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 299 (110.3 bits), Expect = 4.3e-26, P = 4.3e-26
 Identities = 58/106 (54%), Positives = 74/106 (69%)

Query:     1 TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTES 60
             TM+W+M  L+NNPR MKKVQ EIRS IG  K  + E DV +L YLK V+KET+RL P   
Sbjct:   313 TMIWAMAELVNNPRVMKKVQDEIRSCIGIKKERIEEEDVGKLQYLKLVIKETLRLHPAAP 372

Query:    61 LLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYP 106
             LL PRET+ +  I+ Y+I  KT + V  W++GRDP+ W+NPEE  P
Sbjct:   373 LLLPRETMADIKIQGYDIPRKTLLLVSAWSLGRDPKYWKNPEEFNP 418
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031915 CYP71B28 ""cytochrome P450, family 71, subfamily B, polypeptide 28"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093546 CYP71B3 ""cytochrome P450, family 71, subfamily B, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093556 CYP71B24 ""cytochrome P450, family 71, subfamily B, polypeptide 24"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088394 PAD3 "PHYTOALEXIN DEFICIENT 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093536 CYP71B4 ""cytochrome P450, family 71, subfamily B, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079311 CYP71B36 ""cytochrome P450, family 71, subfamily B, polypeptide 36"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093541 CYP71B21 ""cytochrome P450, family 71, subfamily B, polypeptide 21"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP83F2
cytochrome P450 (513 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 3e-28
pfam00067461 pfam00067, p450, Cytochrome P450 5e-26
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 7e-24
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 9e-24
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-23
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 1e-23
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-23
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-19
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 3e-16
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 3e-16
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 7e-16
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 9e-15
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-12
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 9e-12
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 6e-11
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 9e-09
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 2e-06
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 1e-05
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 5e-05
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-04
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 2e-04
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information 
 Score =  105 bits (264), Expect = 3e-28
 Identities = 53/106 (50%), Positives = 72/106 (67%), Gaps = 2/106 (1%)

Query: 2   MVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESL 61
           +VW+MTYL+  P AMKK Q E+R++IG +KG+V+E D+  L YLKAV+KE++RL+P   +
Sbjct: 308 VVWAMTYLIKYPEAMKKAQDEVRNVIG-DKGYVSEEDIPNLPYLKAVIKESLRLEPVIPI 366

Query: 62  LPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETW-QNPEEVYP 106
           L  RETI +  I  Y+I AKT + V  WA+ RD   W  NP E  P
Sbjct: 367 LLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIP 412

Length = 499
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02738 633 carotene beta-ring hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 99.98
PLN02987472 Cytochrome P450, family 90, subfamily A 99.97
PLN02648480 allene oxide synthase 99.97
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.96
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.93
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-39  Score=220.97  Aligned_cols=110  Identities=47%  Similarity=0.769  Sum_probs=106.2

Q ss_pred             CHHHHHHHHHhChHHHHHHHHHHHHhhcCCCCCCCcccccCChhHHHHHHHhcCCCCCCCCCCCccccCCeeecCEEeCC
Q 036805            1 TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQA   80 (111)
Q Consensus         1 tl~~~~~~l~~~p~~~~~l~~e~~~~~~~~~~~~~~~~~~~~~~l~~~i~E~lR~~~~~~~~~~r~~~~~~~~~~~~ip~   80 (111)
                      |+.|++.+|++||++|+|+++|+++++|. ++.++..+..++||++|+|+|++|++|++|+.++|.+.+|+.++||.|||
T Consensus       305 Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~-~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPk  383 (489)
T KOG0156|consen  305 TLEWAMAELLNNPEVQKKLQEEIDEVVGK-GRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPK  383 (489)
T ss_pred             HHHHHHHHHHhCHHHHHHHHHHHHHHhCC-CCCCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCC
Confidence            57899999999999999999999999998 55599999999999999999999999999998999999999999999999


Q ss_pred             CCEEEeehhhhccCCCCCCCCCCcCCCCCCC
Q 036805           81 KTHVFVIRWAIGRDPETWQNPEEVYPGGICL  111 (111)
Q Consensus        81 g~~v~~~~~~~~~d~~~~~~p~~F~p~Rfl~  111 (111)
                      ||.|+++.|++||||++|+||++|+||||++
T Consensus       384 gT~v~vn~~ai~rDp~vw~dP~eF~PERFl~  414 (489)
T KOG0156|consen  384 GTTVLVNLWAIHRDPKVWEDPEEFKPERFLD  414 (489)
T ss_pred             CCEEEEeehhhhcCCccCCCccccChhhhcC
Confidence            9999999999999999999999999999985

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 9e-12
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-10
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 5e-09
3pm0_A507 Structural Characterization Of The Complex Between 9e-08
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 7e-06
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 1e-05
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 1e-05
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 1e-05
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 2e-05
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-05
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-05
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 3e-05
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 3e-05
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 4e-05
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 5e-05
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 2e-04
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-04
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-04
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 3e-04
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-04
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 6e-04
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 6e-04
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 6e-04
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 6e-04
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 6e-04
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 55/106 (51%), Gaps = 7/106 (6%)
Query: 4   WSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLP 63
           WS+ YL+  P   +K+Q E+ ++IG  +     +D  +L YL+A + ET R     S LP
Sbjct: 304 WSLMYLVTKPEIQRKIQKELDTVIGRERR-PRLSDRPQLPYLEAFILETFR---HSSFLP 359
Query: 64  ---PRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYP 106
              P  T  +  +  + I  K  VFV +W +  DPE W++P E  P
Sbjct: 360 FTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPELWEDPSEFRP 405
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 3e-38
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 8e-36
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-33
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 9e-32
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 5e-25
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-22
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-21
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-20
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-19
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 9e-19
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-18
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-18
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-18
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-18
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 7e-18
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-17
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-17
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-17
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-17
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 6e-17
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-16
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 6e-16
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-15
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-15
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-15
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-15
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-15
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 8e-15
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 7e-08
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  132 bits (335), Expect = 3e-38
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 2/106 (1%)

Query: 1   TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTES 60
           T+ W +  +  N +    ++ E+ +             +Q +  LKA +KET+RL P   
Sbjct: 294 TLQWHLYEMARNLKVQDMLRAEVLAARH-QAQGDMATMLQLVPLLKASIKETLRLHPISV 352

Query: 61  LLPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYP 106
            L  R  + + ++  Y I AKT V V  +A+GR+P  + +PE   P
Sbjct: 353 TLQ-RYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDP 397
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.98
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.98
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.97
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.97
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.97
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.96
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.96
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.96
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.96
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.96
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.96
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.96
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.96
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.96
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.96
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.96
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.95
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.95
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.95
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.95
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.95
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.95
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.95
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.95
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.95
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.95
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.95
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.95
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.95
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.95
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.95
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.95
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.95
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.95
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.95
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.95
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.95
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.95
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.95
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.95
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.94
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.94
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.94
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.94
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.94
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.94
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.94
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.94
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.94
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.94
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.93
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.92
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.92
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.83
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=1e-37  Score=210.80  Aligned_cols=110  Identities=21%  Similarity=0.323  Sum_probs=104.8

Q ss_pred             CHHHHHHHHHhChHHHHHHHHHHHHhhcCCCCCCCcccccCChhHHHHHHHhcCCCCCCCCCCCccccCCeeecCEEeCC
Q 036805            1 TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQA   80 (111)
Q Consensus         1 tl~~~~~~l~~~p~~~~~l~~e~~~~~~~~~~~~~~~~~~~~~~l~~~i~E~lR~~~~~~~~~~r~~~~~~~~~~~~ip~   80 (111)
                      +++|++++|++||++|+|+++|++.+++. +..++.+++.++||++|||+|++|++|+++...+|.+.+|++++||.||+
T Consensus       291 ~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~-~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~  369 (479)
T 3tbg_A          291 TLAWGLLLMILHPDVQRRVQQEIDDVIGQ-VRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPK  369 (479)
T ss_dssp             HHHHHHHHHHHCHHHHHHHHHHHHHHTCS-SSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECT
T ss_pred             HHHHHHHHhccCHHHHHHHHHHHHHHHhh-ccccchhhhccccccccceeeeccccccccccceeecCCCceECCEEecC
Confidence            47899999999999999999999999887 67889999999999999999999999999998878889999999999999


Q ss_pred             CCEEEeehhhhccCCCCCCCCCCcCCCCCCC
Q 036805           81 KTHVFVIRWAIGRDPETWQNPEEVYPGGICL  111 (111)
Q Consensus        81 g~~v~~~~~~~~~d~~~~~~p~~F~p~Rfl~  111 (111)
                      |+.|.++.+++||||++|+||++|+||||++
T Consensus       370 Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~  400 (479)
T 3tbg_A          370 GTTLITNLSSVLKDEAVWEKPFRFHPEHFLD  400 (479)
T ss_dssp             TCEEEEEHHHHHTCTTTSSSTTSCCGGGGBC
T ss_pred             CCeeeechhhhcCChhhCCCccccCccccCC
Confidence            9999999999999999999999999999984
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-11
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-10
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-10
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-04
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 8e-04
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.3 bits (134), Expect = 3e-11
 Identities = 26/105 (24%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 2   MVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESL 61
           + W++ ++   P    +VQ EI  ++G N    + +D  ++ Y +AV+ E +R      L
Sbjct: 280 LRWAILFMALYPNIQGQVQKEIDLIMGPNGK-PSWDDKCKMPYTEAVLHEVLRFCNIVPL 338

Query: 62  LPPRETIENCIIEWYEIQAKTHVFVIRWAIGRDPETWQNPEEVYP 106
                T E+ ++  Y I   T V    +++  D + W++PE  +P
Sbjct: 339 GIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHP 383
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.97
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.96
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.91
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.9
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.9
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.89
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.88
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.86
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.86
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.86
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.85
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.85
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.84
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.83
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.79
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.75
d1mo6a260 RecA protein, C-terminal domain {Mycobacterium tub 82.55
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.5e-35  Score=193.77  Aligned_cols=110  Identities=24%  Similarity=0.377  Sum_probs=104.5

Q ss_pred             CHHHHHHHHHhChHHHHHHHHHHHHhhcCCCCCCCcccccCChhHHHHHHHhcCCCCCCCCCCCccccCCeeecCEEeCC
Q 036805            1 TMVWSMTYLMNNPRAMKKVQMEIRSLIGGNKGFVNENDVQELHYLKAVVKETIRLQPTESLLPPRETIENCIIEWYEIQA   80 (111)
Q Consensus         1 tl~~~~~~l~~~p~~~~~l~~e~~~~~~~~~~~~~~~~~~~~~~l~~~i~E~lR~~~~~~~~~~r~~~~~~~~~~~~ip~   80 (111)
                      +++|++++|++||++|+++++|+..+++. .+.++++++.++||++||++|++|++|+++....|.+.+|..++|+.|||
T Consensus       279 ~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~-~~~~~~~~l~~lp~l~a~~~Et~Rl~~~~~~~~~r~~~~~~~~~g~~ipk  357 (463)
T d3czha1         279 VLRWAILFMALYPNIQGQVQKEIDLIMGP-NGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPK  357 (463)
T ss_dssp             HHHHHHHHHHHCHHHHHHHHHHHHHHTCS-SSCCCGGGGGGCHHHHHHHHHHHHHHCSSTTCSCEECSSCEEETTEEECT
T ss_pred             hhhhHHHhhccCcHHHHHHHHHHHhhcCC-CCCCCHHHHHhhhhcccccceeeeeeccccccceecccCCcccCCcEECC
Confidence            47899999999999999999999999887 66789999999999999999999999999987889999999999999999


Q ss_pred             CCEEEeehhhhccCCCCCCCCCCcCCCCCCC
Q 036805           81 KTHVFVIRWAIGRDPETWQNPEEVYPGGICL  111 (111)
Q Consensus        81 g~~v~~~~~~~~~d~~~~~~p~~F~p~Rfl~  111 (111)
                      |+.|.++.+++|+||++|+||++|+||||++
T Consensus       358 G~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~  388 (463)
T d3czha1         358 GTTVITNLYSVHFDEKYWRDPEVFHPERFLD  388 (463)
T ss_dssp             TCEEEEEHHHHHTCTTTCSSTTSCCGGGGBC
T ss_pred             CCcccCcHHHhhCCcccCCChhhcCccccCC
Confidence            9999999999999999999999999999984
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1mo6a2 d.48.1.1 (A:270-329) RecA protein, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure