Citrus Sinensis ID: 036908


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ
ccccccccccccccccccCEcccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHcc
*ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic probableP25858
Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic Key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Essential for the maintenance of cellular ATP levels and carbohydrate metabolism (By similarity). Binds DNA in vitro.probableQ9FX54
Glyceraldehyde-3-phosphate dehydrogenase, cytosolic probableP26521

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E5R, chain O
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL