Citrus Sinensis ID: 036908

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--
AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ
ccccccccccccccccccEEcccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHcc
HHHHccccccEEEEcccccHHHHccccccEEEEHHHcEEEEccEEEEEEEEcccHHHHHHHHHHHHHHHHcc
aesegklkgilgyteddvvstdfvgdsrssifdAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ
aesegklkgilgyteddvvstdFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ
AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ
********GILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVH*****
*ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKT*
AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ
*****KLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query72 2.2.26 [Sep-21-2011]
P25858338 Glyceraldehyde-3-phosphat yes no 0.958 0.204 0.956 4e-32
P25861337 Glyceraldehyde-3-phosphat N/A no 0.986 0.210 0.915 4e-32
Q9FX54338 Glyceraldehyde-3-phosphat yes no 0.958 0.204 0.942 7e-32
P26521338 Glyceraldehyde-3-phosphat N/A no 0.986 0.210 0.901 1e-31
P04796338 Glyceraldehyde-3-phosphat N/A no 0.958 0.204 0.927 1e-31
Q39769340 Glyceraldehyde-3-phosphat N/A no 0.972 0.205 0.885 5e-31
P34924340 Glyceraldehyde-3-phosphat N/A no 1.0 0.211 0.875 5e-31
P17878337 Glyceraldehyde-3-phosphat N/A no 0.986 0.210 0.859 6e-31
P09094326 Glyceraldehyde-3-phosphat N/A no 0.944 0.208 0.911 6e-31
Q41595340 Glyceraldehyde-3-phosphat N/A no 0.972 0.205 0.885 9e-31
>sp|P25858|G3PC1_ARATH Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Arabidopsis thaliana GN=GAPC1 PE=1 SV=2 Back     alignment and function desciption
 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 66/69 (95%), Positives = 68/69 (98%)

Query: 2   ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRV 61
           ESEGKLKGILGYTEDDVVSTDFVGD+RSSIFDAKAGIALS KFVKLVSWYDNEWGYS+RV
Sbjct: 269 ESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRV 328

Query: 62  VDLIVHMSK 70
           VDLIVHMSK
Sbjct: 329 VDLIVHMSK 337

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|P25861|G3PC_ANTMA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|Q9FX54|G3PC2_ARATH Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Arabidopsis thaliana GN=GAPC2 PE=1 SV=1 Back     alignment and function description
>sp|P26521|G3PC_RANAC Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ranunculus acris GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P04796|G3PC_SINAL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2 Back     alignment and function description
>sp|Q39769|G3PC_GINBI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1 Back     alignment and function description
>sp|P34924|G3PC_PINSY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pinus sylvestris GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P17878|G3PC_MESCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Mesembryanthemum crystallinum GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P09094|G3PC_TOBAC Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|Q41595|G3PC_TAXBA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Taxus baccata PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
312282755 294 unnamed protein product [Thellungiella h 0.958 0.234 0.971 5e-31
312282121 338 unnamed protein product [Thellungiella h 0.958 0.204 0.971 6e-31
418731090 337 glyceraldehyde 3-phosphate dehydrogenase 0.986 0.210 0.915 7e-31
310896467145 glyceraldehyde-3-phosphate dehydrogenase 0.958 0.475 0.971 1e-30
350539848 295 glyceraldehyde 3-phosphate dehydrogenase 0.986 0.240 0.901 1e-30
166706 338 cystolic glyceraldehyde-3-phosphate dehy 0.958 0.204 0.956 1e-30
15229231 338 glyceraldehyde-3-phosphate dehydrogenase 0.958 0.204 0.956 2e-30
297828898 338 glyceraldehyde-3-phosphate dehydrogenase 0.958 0.204 0.956 2e-30
241740186 339 glyceraldehyde-3-phosphate dehydrogenase 0.958 0.203 0.942 2e-30
297849736 338 GAPC-2 [Arabidopsis lyrata subsp. lyrata 0.958 0.204 0.956 2e-30
>gi|312282755|dbj|BAJ34243.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 67/69 (97%), Positives = 68/69 (98%)

Query: 2   ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRV 61
           ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALS+ FVKLVSWYDNEWGYSTRV
Sbjct: 225 ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSENFVKLVSWYDNEWGYSTRV 284

Query: 62  VDLIVHMSK 70
           VDLIVHMSK
Sbjct: 285 VDLIVHMSK 293

Source: Thellungiella halophila

Species: Eutrema halophilum

Genus: Eutrema

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|312282121|dbj|BAJ33926.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|418731090|gb|AFX67011.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|310896467|gb|ADP37980.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica napus] Back     alignment and taxonomy information
>gi|350539848|ref|NP_001234803.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum lycopersicum] gi|1931619|gb|AAB51592.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|166706|gb|AAA32794.1| cystolic glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana] gi|166710|gb|AAA32796.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15229231|ref|NP_187062.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Arabidopsis thaliana] gi|20455492|sp|P25858.2|G3PC1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic gi|6721173|gb|AAF26801.1|AC016829_25 glyceraldehyde-3-phosphate dehydrogenase C subunit (GapC) [Arabidopsis thaliana] gi|15529286|gb|AAK97737.1| AT3g04120/T6K12_26 [Arabidopsis thaliana] gi|16974417|gb|AAL31134.1| AT3g04120/T6K12_26 [Arabidopsis thaliana] gi|22655270|gb|AAM98225.1| unknown protein [Arabidopsis thaliana] gi|110741920|dbj|BAE98901.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis thaliana] gi|332640518|gb|AEE74039.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297828898|ref|XP_002882331.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis lyrata subsp. lyrata] gi|297328171|gb|EFH58590.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|241740186|gb|ACS68203.1| glyceraldehyde-3-phosphate dehydrogenase 2 [Brassica napus] Back     alignment and taxonomy information
>gi|297849736|ref|XP_002892749.1| GAPC-2 [Arabidopsis lyrata subsp. lyrata] gi|297338591|gb|EFH69008.1| GAPC-2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
TAIR|locus:2103085338 GAPC1 "glyceraldehyde-3-phosph 0.958 0.204 0.956 5.4e-31
TAIR|locus:2010007338 GAPC2 "glyceraldehyde-3-phosph 0.958 0.204 0.942 8.8e-31
TAIR|locus:2206435422 GAPCP-1 "glyceraldehyde-3-phos 0.930 0.158 0.835 4e-26
SGD|S000003424332 TDH3 "Glyceraldehyde-3-phospha 0.972 0.210 0.785 1.8e-25
TAIR|locus:2032810420 GAPCP-2 "glyceraldehyde-3-phos 0.930 0.159 0.805 1.8e-25
ASPGD|ASPL0000009927336 gpdA [Emericella nidulans (tax 0.944 0.202 0.794 2.2e-25
SGD|S000003769332 TDH2 "Glyceraldehyde-3-phospha 0.972 0.210 0.785 2.2e-25
UNIPROTKB|Q5R2J2333 GAPDH "Glyceraldehyde-3-phosph 1.0 0.216 0.777 4.6e-25
POMBASE|SPBC354.12335 gpd3 "glyceraldehyde 3-phospha 0.930 0.2 0.761 1.1e-23
CGD|CAL0005657335 TDH3 [Candida albicans (taxid: 0.944 0.202 0.764 1.4e-23
TAIR|locus:2103085 GAPC1 "glyceraldehyde-3-phosphate dehydrogenase C subunit 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 5.4e-31, P = 5.4e-31
 Identities = 66/69 (95%), Positives = 68/69 (98%)

Query:     2 ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRV 61
             ESEGKLKGILGYTEDDVVSTDFVGD+RSSIFDAKAGIALS KFVKLVSWYDNEWGYS+RV
Sbjct:   269 ESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRV 328

Query:    62 VDLIVHMSK 70
             VDLIVHMSK
Sbjct:   329 VDLIVHMSK 337
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006006 "glucose metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISS;RCA;IDA;TAS
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IEP;IDA
GO:0005740 "mitochondrial envelope" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA;TAS
GO:0006094 "gluconeogenesis" evidence=RCA;TAS
GO:0042542 "response to hydrogen peroxide" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0009507 "chloroplast" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0008886 "glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity" evidence=IDA
GO:0010154 "fruit development" evidence=IMP
GO:0048316 "seed development" evidence=IMP
GO:0005507 "copper ion binding" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006007 "glucose catabolic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009060 "aerobic respiration" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=TAS
GO:0009408 "response to heat" evidence=IEP
GO:0009744 "response to sucrose stimulus" evidence=IEP
TAIR|locus:2010007 GAPC2 "glyceraldehyde-3-phosphate dehydrogenase C2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000003424 TDH3 "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009927 gpdA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000003769 TDH2 "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R2J2 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Pelodiscus sinensis (taxid:13735)] Back     alignment and assigned GO terms
POMBASE|SPBC354.12 gpd3 "glyceraldehyde 3-phosphate dehydrogenase Gpd3" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0005657 TDH3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P00359G3P3_YEAST1, ., 2, ., 1, ., 1, 20.78570.97220.2108yesno
P04796G3PC_SINAL1, ., 2, ., 1, ., 1, 20.92750.95830.2041N/Ano
Q12552G3P_ASPNG1, ., 2, ., 1, ., 1, 20.77940.94440.2023yesno
P00358G3P2_YEAST1, ., 2, ., 1, ., 1, 20.78570.97220.2108yesno
Q9HGY7G3P_ASPOR1, ., 2, ., 1, ., 1, 20.77140.97220.2071yesno
Q92263G3P_PICPA1, ., 2, ., 1, ., 1, 20.75710.97220.2102yesno
Q0J8A4G3PC1_ORYSJ1, ., 2, ., 1, ., 1, 20.82850.97220.2077yesno
P25861G3PC_ANTMA1, ., 2, ., 1, ., 1, 20.91540.98610.2106N/Ano
Q9FX54G3PC2_ARATH1, ., 2, ., 1, ., 1, 20.94200.95830.2041yesno
P09094G3PC_TOBAC1, ., 2, ., 1, ., 1, 20.91170.94440.2085N/Ano
Q6FSM4G3P2_CANGA1, ., 2, ., 1, ., 1, 20.82350.94440.2048yesno
O43026G3P2_SCHPO1, ., 2, ., 1, ., 1, 20.73910.95830.2059yesno
P26521G3PC_RANAC1, ., 2, ., 1, ., 1, 20.90140.98610.2100N/Ano
Q757I2G3P_ASHGO1, ., 2, ., 1, ., 1, 20.81150.95830.2084yesno
P20445G3P_EMENI1, ., 2, ., 1, ., 1, 20.79410.94440.2023yesno
P25858G3PC1_ARATH1, ., 2, ., 1, ., 1, 20.95650.95830.2041yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 1e-41
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 9e-39
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 6e-35
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 8e-31
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 6e-29
TIGR01534326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 2e-27
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 4e-25
pfam02800157 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh 6e-23
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 6e-22
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 6e-21
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 1e-18
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 1e-15
PLN02237442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 2e-15
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 1e-14
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 2e-14
TIGR01532325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 1e-12
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 2e-05
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information 
 Score =  139 bits (351), Expect = 1e-41
 Identities = 55/69 (79%), Positives = 60/69 (86%)

Query: 1   AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTR 60
             SEG LKGILGYT++DVVS DFVGDSRSSIFDAKAGI LS  F+KLVSWYDNEWGYS R
Sbjct: 347 YASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNR 406

Query: 61  VVDLIVHMS 69
           V+DLI HM+
Sbjct: 407 VLDLIEHMA 415

Length = 421
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 72
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PLN02237442 glyceraldehyde-3-phosphate dehydrogenase B 99.98
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 99.98
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 99.98
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 99.98
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 99.98
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 99.98
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 99.97
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 99.97
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 99.97
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 99.96
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 99.96
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 99.93
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 99.71
KOG0657285 consensus Glyceraldehyde 3-phosphate dehydrogenase 99.62
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.9e-34  Score=205.14  Aligned_cols=70  Identities=71%  Similarity=1.155  Sum_probs=67.0

Q ss_pred             CCcccCcccceeeeccCccccCCCCCcceeEEeCCCceeeeCCeEEEEEEeCCCCchhhhHHHHHHHhhh
Q 036908            1 AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSK   70 (72)
Q Consensus         1 ~aa~g~lkgil~yte~~~VS~Df~~~~~ssi~d~~~t~~~~~~~vki~~WyDNE~gy~~r~~dl~~~~~~   70 (72)
                      +||+|+|||||+|+|+|+||+||+|+|||||||+.+|++++++++|+++||||||||++||+|++++|++
T Consensus       262 ~aa~~~l~gil~~~~~~~VS~D~~~~~~ssi~d~~~t~v~~~~~~k~~~WyDNE~gys~r~~d~~~~~~~  331 (331)
T PRK15425        262 AAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGYSNKVLDLIAHISK  331 (331)
T ss_pred             HHhhccccccccccCCcEeeeecCCCCcceEEEcccCEEecCCEEEEEEEecCchhHHHHHHHHHHHHhC
Confidence            3678999999999999999999999999999999999999999999999999999999999999999864

>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 4e-30
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 4e-30
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 6e-28
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 7e-28
4iq8_A340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 1e-27
3pym_A332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 1e-27
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 2e-27
1gpd_G334 Studies Of Asymmetry In The Three-Dimensional Struc 3e-27
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 3e-27
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 2e-25
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-25
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 5e-25
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 6e-25
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 6e-25
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-24
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 2e-24
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 2e-24
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 4e-24
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 6e-24
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 1e-23
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 2e-23
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 2e-23
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 3e-23
1vsu_A359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 2e-20
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 3e-20
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 1e-19
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-19
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 4e-19
3sth_A361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 7e-19
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 1e-18
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 5e-17
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 5e-17
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-16
1cer_O331 Determinants Of Enzyme Thermostability Observed In 1e-15
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 1e-15
1hdg_O332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 5e-15
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 5e-15
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 6e-15
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 6e-15
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 6e-15
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 1e-14
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 2e-14
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 7e-14
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 7e-13
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 2e-12
2d2i_A380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 2e-12
3b1j_A339 Crystal Structure Of Dehydrogenese Length = 339 2e-12
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 7e-12
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 2e-11
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 1e-10
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 1e-10
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 1e-10
2pkr_O365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 1e-10
3k2b_A337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 2e-10
4dib_A345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 2e-10
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 2e-10
2pkq_O368 Crystal Structure Of The Photosynthetic A2b2-Glycer 3e-10
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 2e-08
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 2e-08
3vaz_P344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 2e-08
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 2e-08
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 2e-08
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 2e-08
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 2e-08
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 2e-08
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 5e-08
2xf8_A338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 5e-08
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 6e-08
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure 
Iteration: 1

 Score =  126 bits (316), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 58/70 (82%), Positives = 65/70 (92%)
Query: 3   SEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVV 62
           SEGKLKGI+GY E+D+VSTDFVGDSRSSIFDAKAGIAL+  FVKLV+WYDNEWGYS RV+
Sbjct: 267 SEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVI 326
Query: 63  DLIVHMSKTQ 72
           DLI HM+KTQ
Sbjct: 327 DLIRHMAKTQ 336
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 3e-49
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 7e-49
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 1e-48
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 2e-48
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 2e-48
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 3e-48
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 4e-48
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 5e-46
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 5e-41
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 2e-38
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 2e-38
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 4e-38
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 5e-38
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 8e-38
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 5e-37
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 8e-37
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 7e-35
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 2e-34
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 3e-34
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 6e-33
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 4e-31
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 1e-21
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
 Score =  156 bits (396), Expect = 3e-49
 Identities = 50/70 (71%), Positives = 61/70 (87%)

Query: 1   AESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTR 60
           A +EG++KG+LGYTEDDVVSTDF G+  +S+FDAKAGIAL+  FVKLVSWYDNE GYS +
Sbjct: 261 AAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGYSNK 320

Query: 61  VVDLIVHMSK 70
           V+DLI H+SK
Sbjct: 321 VLDLIAHISK 330
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 99.97
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
Probab=100.00  E-value=1.4e-36  Score=217.26  Aligned_cols=71  Identities=82%  Similarity=1.319  Sum_probs=69.1

Q ss_pred             CcccCcccceeeeccCccccCCCCCcceeEEeCCCceeeeCCeEEEEEEeCCCCchhhhHHHHHHHhhhcC
Q 036908            2 ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHMSKTQ   72 (72)
Q Consensus         2 aa~g~lkgil~yte~~~VS~Df~~~~~ssi~d~~~t~~~~~~~vki~~WyDNE~gy~~r~~dl~~~~~~~~   72 (72)
                      |++|+|||||+|||+|+||+||+|+|||||||+.+|++++++++|+++||||||||++||+||+.+|+++|
T Consensus       267 a~~g~lkgil~yte~~~VS~Df~~~~~ssi~d~~~~~~~~~~~vk~~~WYDNE~gys~r~~dl~~~~~~~~  337 (337)
T 3v1y_O          267 ASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKTQ  337 (337)
T ss_dssp             HHHTTTBTTEEEECSCCCGGGGTTCCCSEEEETTTCEEEETTEEEEEEEECTTHHHHHHHHHHHHHHHHCC
T ss_pred             hccCccCCeeEEEcCCEEeeccCCCCcceEEecccCeEECCCEEEEEEEECCccchHHHHHHHHHHHhccC
Confidence            67899999999999999999999999999999999999999999999999999999999999999999875
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 72
d1rm4a2163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 7e-24
d3cmco2163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 8e-24
d1u8fo2164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 9e-23
d1obfo2162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 2e-22
d2g82a2162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 2e-20
d1k3ta2169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 5e-18
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Spinach (Spinacia oleracea) [TaxId: 3562]

 Score = 85.7 bits (212), Expect = 7e-24
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 3   SEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYD 52
           ++ +LKGIL   ++ +VS DF     SS  D+   + +    VK+++WYD
Sbjct: 114 ADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYD 163
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.87
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.86
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.86
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.83
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.79
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.79
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Bacillus stearothermophilus, nca 1503 [TaxId: 1422]

Probab=99.87  E-value=1.2e-23  Score=136.48  Aligned_cols=51  Identities=49%  Similarity=0.857  Sum_probs=49.7

Q ss_pred             CcccCcccceeeeccCccccCCCCCcceeEEeCCCceeeeCCeEEEEEEeC
Q 036908            2 ESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYD   52 (72)
Q Consensus         2 aa~g~lkgil~yte~~~VS~Df~~~~~ssi~d~~~t~~~~~~~vki~~WyD   52 (72)
                      |++++|||||+|+++|+||+||+|+|||+|||+.+|++++++++|+++|||
T Consensus       113 as~~~lkgil~~t~~plVSsDf~g~~~SsI~D~~~t~v~~~~~vKv~aWYD  163 (163)
T d3cmco2         113 AAEGELKGILAYSEEPLVSRDYNGSTVSSTIDALSTMVIDGKMVKVVSWYD  163 (163)
T ss_dssp             HHHTTTTTTEEEECSCCCGGGGTTCCSSEEEEGGGCEEETTTEEEEEEEEC
T ss_pred             HhcCCccCcceeeecccchhhccCCCccEEEEcccCEEECCCEEEEEEEeC
Confidence            678999999999999999999999999999999999999999999999998
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure