Citrus Sinensis ID: 036919

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
GRSFFGGLGSLLSGLLTTSHEMASCNFLSQLQRTFIQMRTVLKVADNSGVKTVMCIQPLKGKKVARLGDTIVVSVKEVMPNAKVKKGEVVKAVVVRAAMDHGRCDGSFVKFDDNAVVLIDNLCVLAFAEHTA
cccccccccccccccccccccccEEcHHHHcccccEEcccEEEEECcccccEEEEEEECccccccccccEEEEEEEccccccccccccEEEEEEEEEcccEEcccccEEECcccEEEEEccccccccEEEcc
*********************MASCNFLSQLQRTFIQMRTVLKVADNSGVKTVMCIQPLKGKKVARLGDTIVVSVKEVMPNAKVKKGEVVKAVVVRAAMDHGRCDGSFVKFDDNAVVLIDNLCVLAF*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GRSFFGGLGSLLSGLLTTSHEMASCNFLSQLQRTFIQMRTVLKVADNSGVKTVMCIQPLKGKKVARLGDTIVVSVKEVMPNAKVKKGEVVKAVVVRAAMDHGRCDGSFVKFDDNAVVLIDNLCVLAFAEHTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L14 Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome.probableB8G6R5
50S ribosomal protein L14 Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome.probableQ2K9K6
50S ribosomal protein L14 Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome.probableB3E7U5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain M
Confidence level:very confident
Coverage over the Query: 35-131
View the alignment between query and template
View the model in PyMOL