Citrus Sinensis ID: 036950


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSASSMAKQEPAPMVLIARHDTSIKLSMIAIESTRTVLISPLL
cccccEEEEEEccccccccccccccccccccccHHHHcccccccccccccccEEEEEEEccccccccccccEEEEEEEEEEccccEEECcccEEEEEcccccccHHHHHHHccccccEEEEEEcccccccccccccccccccccccccEEEEEEEEEcccccccccccccEEEEcccccccccccEEEEEEEEccCEEECccccccccEEEEcccccccHHHHHHHHccccccEEEEEEcccccccccccccccccccccCEEEEEEEEEEEccccccccccHHHHHHHHHccccccHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccHHccccccHHHHHHHHHccccEEEccccc
*K*GENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSS*****KQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKIN*********************************IAIESTRTVLISPLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSASSMAKQEPAPMVLIARHDTSIKLSMIAIESTRTVLISPLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase FKBP4 Immunophilin protein with PPIase and co-chaperone activities (By similarity). Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90) (By similarity). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments (By similarity). The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening (By similarity). Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly.probableQ9TRY0
Peptidyl-prolyl cis-trans isomerase FKBP65 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Co-chaperone that negatively modulates thermotolerance by interacting with FKBP62 and decreasing the HSFA2-mediated accumulation of chaperones of the small-HSPs family. Plays a positive role in tolerance to intracellular acid stress by maintaining the pH homeostasis.probableQ9FJL3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JXV, chain A
Confidence level:very confident
Coverage over the Query: 42-274
View the alignment between query and template
View the model in PyMOL
Template: 1KT0, chain A
Confidence level:very confident
Coverage over the Query: 53-416
View the alignment between query and template
View the model in PyMOL
Template: 2Y4T, chain A
Confidence level:very confident
Coverage over the Query: 291-323,335-467
View the alignment between query and template
View the model in PyMOL