Citrus Sinensis ID: 036950


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSASSMAKQEPAPMVLIARHDTSIKLSMIAIESTRTVLISPLL
cccccEEEEEEccccccccccccccccccccccHHHHcccccccccccccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEEcccEEEEEcccccccHHHHHHHccccccEEEEEEcccccccccccccccccccccccccEEEEEEEEEcccccccccccccEEEEcccccccccccEEEEEEEEccEEEEEccccccccEEEEcccccccHHHHHHHHccccccEEEEEEcccccccccccccccccccccEEEEEEEEEEEEccccccccccHHHHHHHHHccccccHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccHHccccccHHHHHHHHHccccEEEccccc
cccccEEEEEEcHHHccccccEcccEcccccEEEEEEEEEccccccccccccEEEEEEEccccccccccccEEEEEEEEEEccccEEcccccEEEEEcccccHHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccEEEEEEEEEEccccccccccccEEEcEEEcccccccccccEEEEEEcccEEEcccccccccEEEEcccccccHHHHHHHcccccccEEEEEEcHHHccccccccccccccccccEEEEEEEEEEEccccccEEEcccccHHHHcHcccccccEccccHHHHHHHHHHHHHHHccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcHHHHHEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEHcHccccEEEcEEEEEcccEEEEcccc
mkkgenavftippelaygesgspptippnamlqFDVELLGWTSVKDICKDGGIFKKILVEgkkwenpkdldEVFVKYEVRLedgtlisksdgveftvgdGYFCAALAKAVKTMKKGEKVLLTVkpqyafgkngrpatgdedavpsnanLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLhdgtvfvkkghdeeplfefkideEQVIDGLDRAVKTMKKGEVALVTiepeyafgscssekelaivpanstlFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNyigydssfsdEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKaleidpdnsleagwGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAksassmakqepapmvlIARHDTSIKLSMIAIESTRTVLISPLL
mkkgenavftippelaygesGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILvegkkwenpkdldeVFVKYEVRledgtlisksdgvefTVGDGYFCAALAKAVKTMKKGEKVLltvkpqyafgkngrpatgdedaVPSNANLHITLEMvswktvsditkdkKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPlfefkideeqvIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIeaagkkkeegnvLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLeldkldikkaleidpdnsleagwgvRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSASSMAKQEPAPMVLIARHDTSIKLSMiaiestrtvlispll
MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSditkdkkvlkkilkEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQekieaagkkkeegNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSASSMAKQEPAPMVLIARHDTSIKLSMIAIESTRTVLISPLL
*****************************AMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFG****************ANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESW*******************VLFKAGKYERASKRYEQAVNYIGYDSS*******QAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKIN************************************************
*K*GENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSE***AIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSS*****KQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVRE**KKDVQFYG****************************************IAIESTRTVLISPLL
MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLE***********EPAPMVLIARHDTSIKLSMIAIESTRTVLISPLL
*KKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSAS*******APMVLIARHDTSIKLSMIAIESTRTVLISPLL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQMMVQWFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVLELDKLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSASSMAKQEPAPMVLIARHDTSIKLSMIAIESTRTVLISPLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query469 2.2.26 [Sep-21-2011]
Q9FJL3578 Peptidyl-prolyl cis-trans yes no 0.882 0.716 0.688 1e-172
Q38931551 Peptidyl-prolyl cis-trans no no 0.886 0.754 0.684 1e-171
Q43207559 70 kDa peptidyl-prolyl is N/A no 0.886 0.744 0.691 1e-166
Q02790459 Peptidyl-prolyl cis-trans yes no 0.784 0.801 0.329 3e-52
Q9TRY0459 Peptidyl-prolyl cis-trans yes no 0.801 0.819 0.329 1e-51
P30416458 Peptidyl-prolyl cis-trans yes no 0.784 0.803 0.322 2e-49
Q9QVC8458 Peptidyl-prolyl cis-trans yes no 0.784 0.803 0.320 1e-48
P27124458 Peptidyl-prolyl cis-trans yes no 0.784 0.803 0.322 2e-45
Q9XSI2457 Peptidyl-prolyl cis-trans N/A no 0.752 0.772 0.326 3e-45
Q64378456 Peptidyl-prolyl cis-trans no no 0.825 0.848 0.305 2e-44
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function desciption
 Score =  605 bits (1559), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 312/453 (68%), Positives = 367/453 (81%), Gaps = 39/453 (8%)

Query: 1   MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVE 60
           MKKGENA+FTIPPELAYGE+GSPPTIPPNA LQFDVEL+ W SVKDIC DGG+ KKI+VE
Sbjct: 112 MKKGENAIFTIPPELAYGETGSPPTIPPNATLQFDVELIAWRSVKDICGDGGVSKKIIVE 171

Query: 61  GKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVL 120
           G+KWE PKDLDEV+VKYE RLEDGT++ KSDGVEFTV +G+FC AL+KAVKTMK+GEKVL
Sbjct: 172 GEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGVEFTVKEGHFCPALSKAVKTMKRGEKVL 231

Query: 121 LTVKPQYAFGKNGRPAT-GDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGD 179
           LTVKPQY FG+ GRPA+ G + A+P NA L I LE+VSWKTV ++T D+KV+KKILKEG+
Sbjct: 232 LTVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELVSWKTVVEVTDDRKVIKKILKEGE 291

Query: 180 GYE--NQMMVQWFKL----HDGT-VFVKKGH--DEEPLFEFKIDEEQVIDGLDRAVKTMK 230
           GYE  N+  +   KL     DGT VFVKKGH  DEEP FEFKIDEEQVI+GL++AV  MK
Sbjct: 292 GYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEP-FEFKIDEEQVIEGLEKAVMGMK 350

Query: 231 KGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAA 290
           KGEVAL+TI PEYAFGS  S++ELA++P NST++YEVELVSFIKEKESWDMNTQE+IEAA
Sbjct: 351 KGEVALITISPEYAFGSSESKQELAVIPPNSTVYYEVELVSFIKEKESWDMNTQERIEAA 410

Query: 291 GKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKL 350
           GKKKEEGNVLFKAGKY RASKRYE+ V YI YDS+F +EEK+++K LKI CNLN+AACKL
Sbjct: 411 GKKKEEGNVLFKAGKYARASKRYERGVKYIEYDSTFDEEEKKKSKDLKIACNLNDAACKL 470

Query: 351 KLKEYKQAEKLCSKVLELD-----------------------KLDIKKALEIDPDNSLEA 387
           KLK+YK+A KL +KVLE+D                       +LDIKKALEIDPDN    
Sbjct: 471 KLKDYKEAAKLSTKVLEMDSRNVKAMYRRAHAYLETADLDLAELDIKKALEIDPDNK--- 527

Query: 388 GWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKI 420
              V++EYK LKEKV+EYNKKD +FY N+ +K+
Sbjct: 528 --EVKIEYKKLKEKVKEYNKKDAKFYSNMLSKM 558




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Co-chaperone that negatively modulates thermotolerance by interacting with FKBP62 and decreasing the HSFA2-mediated accumulation of chaperones of the small-HSPs family. Plays a positive role in tolerance to intracellular acid stress by maintaining the pH homeostasis.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 Back     alignment and function description
>sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 Back     alignment and function description
>sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 Back     alignment and function description
>sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 Back     alignment and function description
>sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 Back     alignment and function description
>sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 Back     alignment and function description
>sp|Q64378|FKBP5_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Mus musculus GN=Fkbp5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
356528282 570 PREDICTED: 70 kDa peptidyl-prolyl isomer 0.927 0.763 0.726 0.0
356512417 570 PREDICTED: 70 kDa peptidyl-prolyl isomer 0.933 0.768 0.723 0.0
224131530 577 predicted protein [Populus trichocarpa] 0.936 0.760 0.732 0.0
118486491 608 unknown [Populus trichocarpa] 0.916 0.707 0.733 0.0
355329948 573 FK506-binding protein [Nicotiana tabacum 0.936 0.766 0.700 0.0
224065421 575 predicted protein [Populus trichocarpa] 0.925 0.754 0.697 0.0
359497288 571 PREDICTED: 70 kDa peptidyl-prolyl isomer 0.921 0.756 0.700 0.0
449498811 571 PREDICTED: peptidyl-prolyl cis-trans iso 0.927 0.761 0.696 0.0
449459832 571 PREDICTED: peptidyl-prolyl cis-trans iso 0.927 0.761 0.694 0.0
255589766 574 peptidylprolyl isomerase, putative [Rici 0.916 0.749 0.696 1e-180
>gi|356528282|ref|XP_003532733.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] Back     alignment and taxonomy information
 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/471 (72%), Positives = 392/471 (83%), Gaps = 36/471 (7%)

Query: 1   MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVE 60
           MKKGENA+FTIPPELAYGESGSPPTIPPNA LQFDVELL WTSVKDICKDGGI K I+ E
Sbjct: 103 MKKGENALFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGILKNIITE 162

Query: 61  GKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVL 120
           G+KW+NPKDLDEVFVKYE RLEDG +ISKSDGVEFTV +GYFC ALAKAVKTMKKGEKVL
Sbjct: 163 GEKWDNPKDLDEVFVKYEARLEDGIVISKSDGVEFTVEEGYFCPALAKAVKTMKKGEKVL 222

Query: 121 LTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDG 180
           L VKPQYAFG++GRPA+GDE AVP NA+L + LE+VSWKTVSDIT D+KVLKK LKEG+G
Sbjct: 223 LNVKPQYAFGESGRPASGDEGAVPPNASLQVDLELVSWKTVSDITNDRKVLKKTLKEGEG 282

Query: 181 YE---NQMMVQ---WFKLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEV 234
           YE   +  +VQ     KL DGTVF+KKG+D++  FEFKIDEEQV DGLD+AVK+MKKGE+
Sbjct: 283 YERPNDGAVVQVKLIGKLQDGTVFIKKGYDDQQPFEFKIDEEQVTDGLDQAVKSMKKGEI 342

Query: 235 ALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQEKIEAAGKKK 294
           AL+ I+PEYAFG   S +ELA VP NST++YEVEL+SFIKEKESWD+NTQEKIEAAGKKK
Sbjct: 343 ALLIIQPEYAFGPSGSSQELANVPPNSTVYYEVELLSFIKEKESWDLNTQEKIEAAGKKK 402

Query: 295 EEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKE 354
           EEGN LFK GKYERASKRYE+A+ ++ YDSSFSDEEKQ+ K LKITCNLNNAACKLKLK+
Sbjct: 403 EEGNALFKVGKYERASKRYEKAIKFVEYDSSFSDEEKQKTKALKITCNLNNAACKLKLKD 462

Query: 355 YKQAEKLCSKVLELD-----------------------KLDIKKALEIDPDNSLEAGWGV 391
           YKQAEK+C+KVLELD                       ++DIKKALEI+PDN       V
Sbjct: 463 YKQAEKMCTKVLELDSRNVKALYRRAQGYLHLVDLDLAEMDIKKALEIEPDNR-----DV 517

Query: 392 RMEYKLLKEKVREYNKKDVQFYGNIFAKINKLEQAKSASSMAKQEPAPMVL 442
           +MEYK+LK+KVREYNKKD QFY +IFAK+NKLEQA++A+  AKQEP PM +
Sbjct: 518 KMEYKILKQKVREYNKKDAQFYSSIFAKMNKLEQARTAT--AKQEPVPMTI 566




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356512417|ref|XP_003524915.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|224131530|ref|XP_002321107.1| predicted protein [Populus trichocarpa] gi|222861880|gb|EEE99422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118486491|gb|ABK95085.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|355329948|dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224065421|ref|XP_002301809.1| predicted protein [Populus trichocarpa] gi|222843535|gb|EEE81082.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359497288|ref|XP_002263566.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Vitis vinifera] gi|296085741|emb|CBI29552.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449498811|ref|XP_004160641.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449459832|ref|XP_004147650.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255589766|ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223524081|gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
TAIR|locus:2152561578 ROF2 "AT5G48570" [Arabidopsis 0.795 0.645 0.677 1.5e-149
UNIPROTKB|Q6K5Q1682 P0579G08.8 "Putative peptidylp 0.795 0.546 0.643 3e-144
UNIPROTKB|Q7F1F2580 OJ1191_A10.119 "cDNA clone:J03 0.933 0.755 0.625 1.7e-139
TAIR|locus:2090265562 ROF1 "AT3G25230" [Arabidopsis 0.795 0.663 0.685 3.7e-135
UNIPROTKB|Q9XFE4585 OSJNBa0091C07.4 "OSJNBa0091C07 0.797 0.639 0.658 3.8e-133
UNIPROTKB|Q657L6422 P0468H06.14-3 "Peptidyl-prolyl 0.579 0.644 0.449 5.3e-56
UNIPROTKB|A8J0I6569 FKB62 "Peptidyl-prolyl cis-tra 0.599 0.493 0.38 1.8e-48
UNIPROTKB|Q02790459 FKBP4 "Peptidyl-prolyl cis-tra 0.663 0.677 0.365 2.9e-48
UNIPROTKB|F1MU79459 FKBP4 "Peptidyl-prolyl cis-tra 0.663 0.677 0.356 6e-48
UNIPROTKB|Q9TRY0459 FKBP4 "Peptidyl-prolyl cis-tra 0.663 0.677 0.356 7.7e-48
TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1312 (466.9 bits), Expect = 1.5e-149, Sum P(2) = 1.5e-149
 Identities = 260/384 (67%), Positives = 304/384 (79%)

Query:     1 MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVE 60
             MKKGENA+FTIPPELAYGE+GSPPTIPPNA LQFDVEL+ W SVKDIC DGG+ KKI+VE
Sbjct:   112 MKKGENAIFTIPPELAYGETGSPPTIPPNATLQFDVELIAWRSVKDICGDGGVSKKIIVE 171

Query:    61 GKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVL 120
             G+KWE PKDLDEV+VKYE RLEDGT++ KSDGVEFTV +G+FC AL+KAVKTMK+GEKVL
Sbjct:   172 GEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGVEFTVKEGHFCPALSKAVKTMKRGEKVL 231

Query:   121 LTVKPQYAFGKNGRPAT-GDEDAVPSNANLHITLEMVSWKTVSXXXXXXXXXXXXXXEGD 179
             LTVKPQY FG+ GRPA+ G + A+P NA L I LE+VSWKTV               EG+
Sbjct:   232 LTVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELVSWKTVVEVTDDRKVIKKILKEGE 291

Query:   180 GYE--NQMMVQWFKL----HDGT-VFVKKGH--DEEPLFEFKIDEEQVIDGLDRAVKTMK 230
             GYE  N+  +   KL     DGT VFVKKGH  DEEP FEFKIDEEQVI+GL++AV  MK
Sbjct:   292 GYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEP-FEFKIDEEQVIEGLEKAVMGMK 350

Query:   231 KGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWDMNTQXXXXXX 290
             KGEVAL+TI PEYAFGS  S++ELA++P NST++YEVELVSFIKEKESWDMNTQ      
Sbjct:   351 KGEVALITISPEYAFGSSESKQELAVIPPNSTVYYEVELVSFIKEKESWDMNTQERIEAA 410

Query:   291 XXXXXXXNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKL 350
                    NVLFKAGKY RASKRYE+ V YI YDS+F +EEK+++K LKI CNLN+AACKL
Sbjct:   411 GKKKEEGNVLFKAGKYARASKRYERGVKYIEYDSTFDEEEKKKSKDLKIACNLNDAACKL 470

Query:   351 KLKEYKQAEKLCSKVLELDKLDIK 374
             KLK+YK+A KL +KVLE+D  ++K
Sbjct:   471 KLKDYKEAAKLSTKVLEMDSRNVK 494


GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;RCA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0005516 "calmodulin binding" evidence=ISS
GO:0005773 "vacuole" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0070370 "cellular heat acclimation" evidence=IMP
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q657L6 P0468H06.14-3 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8J0I6 FKB62 "Peptidyl-prolyl cis-trans isomerase, FKBP-type" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q02790 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MU79 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TRY0 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9TRY0FKBP4_BOVIN5, ., 2, ., 1, ., 80.32930.80170.8191yesno
Q9FJL3FKB65_ARATH5, ., 2, ., 1, ., 80.68870.88270.7162yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.963
4th Layer5.2.1.80.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 7e-20
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 7e-17
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 2e-12
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 9e-12
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 6e-10
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 3e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-06
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 1e-05
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 1e-05
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 3e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-05
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 5e-05
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 6e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.001
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
 Score = 83.8 bits (208), Expect = 7e-20
 Identities = 34/80 (42%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 191 KLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSS 250
           KL DGTVF       +P FEF +   QVI G D  +  MK GE   +TI PE A+G    
Sbjct: 18  KLEDGTVFDSSKDRGKP-FEFTLGSGQVIPGWDEGLLGMKVGEKRKLTIPPELAYG--EE 74

Query: 251 EKELAIVPANSTLFYEVELV 270
                ++P N+TL +EVEL+
Sbjct: 75  GLAGGVIPPNATLVFEVELL 94


Length = 94

>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 469
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 100.0
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.96
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.95
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.93
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.93
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.9
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.89
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.88
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.85
KOG4234271 consensus TPR repeat-containing protein [General f 99.8
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.8
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.79
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.79
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.72
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.71
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.7
KOG0553304 consensus TPR repeat-containing protein [General f 99.7
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.67
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.64
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.61
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.55
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.53
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.49
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.4
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.39
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.38
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.38
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.36
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.35
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.27
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.07
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.07
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.0
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 98.99
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.96
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 98.94
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.93
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.88
TIGR00115408 tig trigger factor. Trigger factor is a ribosome-a 98.83
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.82
COG0544441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.77
PRK01490435 tig trigger factor; Provisional 98.74
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.55
PRK15359144 type III secretion system chaperone protein SscB; 98.55
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.49
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.42
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.36
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.28
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.23
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.21
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.19
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.14
PF1337173 TPR_9: Tetratricopeptide repeat 98.13
KOG4555175 consensus TPR repeat-containing protein [Function 98.1
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.09
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.08
TIGR00115408 tig trigger factor. Trigger factor is a ribosome-a 98.07
PRK11189296 lipoprotein NlpI; Provisional 97.92
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.91
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.9
PRK15359144 type III secretion system chaperone protein SscB; 97.89
PRK01490435 tig trigger factor; Provisional 97.86
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 97.84
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 97.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.79
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.74
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.74
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.69
PRK10370198 formate-dependent nitrite reductase complex subuni 97.63
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.58
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.53
PRK10370198 formate-dependent nitrite reductase complex subuni 97.52
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.52
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.52
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.49
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.48
KOG1126638 consensus DNA-binding cell division cycle control 97.47
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.41
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.36
PRK12370553 invasion protein regulator; Provisional 97.34
PRK11189296 lipoprotein NlpI; Provisional 97.27
KOG1310 758 consensus WD40 repeat protein [General function pr 97.27
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.24
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.24
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.22
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.21
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.21
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.2
COG0544441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 97.19
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.17
PRK15331165 chaperone protein SicA; Provisional 97.16
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.16
KOG2003 840 consensus TPR repeat-containing protein [General f 97.14
PF13512142 TPR_18: Tetratricopeptide repeat 97.07
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.05
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.05
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.03
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.02
KOG0553304 consensus TPR repeat-containing protein [General f 96.99
PLN02789320 farnesyltranstransferase 96.96
PRK10803263 tol-pal system protein YbgF; Provisional 96.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 96.93
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.92
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.87
KOG1129478 consensus TPR repeat-containing protein [General f 96.86
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.86
PRK11788389 tetratricopeptide repeat protein; Provisional 96.85
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 96.81
KOG1125579 consensus TPR repeat-containing protein [General f 96.78
PRK11788389 tetratricopeptide repeat protein; Provisional 96.76
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.74
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 96.74
KOG1126638 consensus DNA-binding cell division cycle control 96.73
PRK12370553 invasion protein regulator; Provisional 96.73
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 96.66
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.66
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.65
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.64
KOG4234271 consensus TPR repeat-containing protein [General f 96.64
KOG0547 606 consensus Translocase of outer mitochondrial membr 96.62
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.6
PF1343134 TPR_17: Tetratricopeptide repeat 96.54
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.53
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.53
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.53
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.47
KOG2003 840 consensus TPR repeat-containing protein [General f 96.46
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.43
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.41
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 96.4
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.4
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 96.38
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.38
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.36
KOG2076 895 consensus RNA polymerase III transcription factor 96.36
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.3
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 96.27
KOG4648 536 consensus Uncharacterized conserved protein, conta 96.25
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 96.24
PLN02789320 farnesyltranstransferase 96.23
KOG2076 895 consensus RNA polymerase III transcription factor 96.15
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.13
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 96.13
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.04
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.0
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.98
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.97
PRK14574 822 hmsH outer membrane protein; Provisional 95.97
PF1342844 TPR_14: Tetratricopeptide repeat 95.9
PRK14720 906 transcript cleavage factor/unknown domain fusion p 95.85
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.83
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.81
PRK10803263 tol-pal system protein YbgF; Provisional 95.79
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 95.78
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.59
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.57
KOG1125579 consensus TPR repeat-containing protein [General f 95.56
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.48
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 95.41
KOG4340 459 consensus Uncharacterized conserved protein [Funct 95.4
PRK14574 822 hmsH outer membrane protein; Provisional 95.37
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 95.35
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.25
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.05
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.03
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.96
PRK15331165 chaperone protein SicA; Provisional 94.94
PF1286294 Apc5: Anaphase-promoting complex subunit 5 94.86
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 94.74
PF12688120 TPR_5: Tetratrico peptide repeat 94.62
KOG1586288 consensus Protein required for fusion of vesicles 94.62
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.59
KOG1128 777 consensus Uncharacterized conserved protein, conta 94.41
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 94.37
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.26
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 93.99
PF12688120 TPR_5: Tetratrico peptide repeat 93.94
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.87
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 93.69
KOG3060289 consensus Uncharacterized conserved protein [Funct 93.67
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 93.6
COG3947361 Response regulator containing CheY-like receiver a 93.58
KOG3785 557 consensus Uncharacterized conserved protein [Funct 93.49
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.38
PF1342844 TPR_14: Tetratricopeptide repeat 93.23
cd05804355 StaR_like StaR_like; a well-conserved protein foun 93.18
KOG3364149 consensus Membrane protein involved in organellar 93.13
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 93.09
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 92.88
PRK10153517 DNA-binding transcriptional activator CadC; Provis 92.86
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.84
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 92.66
KOG2376 652 consensus Signal recognition particle, subunit Srp 92.63
COG4235287 Cytochrome c biogenesis factor [Posttranslational 92.53
COG4235287 Cytochrome c biogenesis factor [Posttranslational 92.42
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 92.11
COG4700251 Uncharacterized protein conserved in bacteria cont 91.65
cd05804355 StaR_like StaR_like; a well-conserved protein foun 91.61
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 91.57
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 91.54
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 91.51
PF06552186 TOM20_plant: Plant specific mitochondrial import r 91.47
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 91.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 91.28
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.18
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 91.17
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 91.11
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 91.11
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 91.11
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.1
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 91.06
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.03
PRK14720 906 transcript cleavage factor/unknown domain fusion p 91.0
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 90.74
PRK10153517 DNA-binding transcriptional activator CadC; Provis 90.53
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 90.43
KOG1941 518 consensus Acetylcholine receptor-associated protei 90.22
KOG1129478 consensus TPR repeat-containing protein [General f 89.85
KOG1128777 consensus Uncharacterized conserved protein, conta 89.63
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 89.58
PF0421269 MIT: MIT (microtubule interacting and transport) d 89.26
PF13512142 TPR_18: Tetratricopeptide repeat 89.18
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 89.15
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 89.04
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 88.99
KOG2796366 consensus Uncharacterized conserved protein [Funct 88.88
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 88.66
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.64
KOG4162799 consensus Predicted calmodulin-binding protein [Si 88.46
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 88.42
cd0265675 MIT MIT: domain contained within Microtubule Inter 88.18
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 88.05
PRK10941269 hypothetical protein; Provisional 87.89
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 87.47
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 87.46
COG4783484 Putative Zn-dependent protease, contains TPR repea 87.31
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.03
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 86.31
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 86.3
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 86.27
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 86.05
KOG3785 557 consensus Uncharacterized conserved protein [Funct 85.81
smart0074577 MIT Microtubule Interacting and Trafficking molecu 84.87
KOG3060289 consensus Uncharacterized conserved protein [Funct 84.64
KOG1585308 consensus Protein required for fusion of vesicles 84.59
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 84.37
PRK10747398 putative protoheme IX biogenesis protein; Provisio 84.09
cd0267979 MIT_spastin MIT: domain contained within Microtubu 84.08
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 83.67
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 83.07
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 82.76
KOG4162799 consensus Predicted calmodulin-binding protein [Si 82.75
COG2976207 Uncharacterized protein conserved in bacteria [Fun 82.6
PF1337173 TPR_9: Tetratricopeptide repeat 82.3
KOG0495913 consensus HAT repeat protein [RNA processing and m 82.25
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 82.08
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 82.07
smart0074577 MIT Microtubule Interacting and Trafficking molecu 81.96
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 81.02
COG3118304 Thioredoxin domain-containing protein [Posttransla 80.85
KOG4507886 consensus Uncharacterized conserved protein, conta 80.75
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 80.39
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=5.7e-60  Score=454.91  Aligned_cols=330  Identities=47%  Similarity=0.770  Sum_probs=304.9

Q ss_pred             ecCCccCCCCCCCEEEEEEEEEecCCcEEecc---ccEEEEECCCccchhHHHHHhcccCCcEEEEEEcCCccccCCCCC
Q 036950           59 VEGKKWENPKDLDEVFVKYEVRLEDGTLISKS---DGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGKNGRP  135 (469)
Q Consensus        59 ~~G~g~~~~~~gd~V~i~y~~~~~~G~~~~~t---~~~~~~ig~~~~~~gle~aL~gmk~Ge~~~~~ip~~~ayg~~~~~  135 (469)
                      .+|+|+..|..||.|.+||++++.||+.|+||   .|+.|.+|.|.++.||..++.+|+.              |+.+.+
T Consensus         1 ~eg~g~~~p~~g~~v~~hytg~l~dgt~fdss~d~~~~~~~lg~g~vi~~~~~gv~tm~~--------------g~~~~p   66 (397)
T KOG0543|consen    1 KEGTGTETPMTGDKVEVHYTGTLLDGTKFDSSRDGDPFKFDLGKGSVIKGWDLGVATMKK--------------GEAGSP   66 (397)
T ss_pred             CCCCCccCCCCCceeEEEEeEEecCCeecccccCCCceeeecCCCccccccccccccccc--------------cccCCC
Confidence            37899899999999999999999999999999   5999999999999999999999998              444443


Q ss_pred             CCCCCCCCCCCceEEEeEeeeeeccccccccchhhhhhhhhcCCC-CCCCc-----eEE-EEEecCCcEEEecCCCCCCc
Q 036950          136 ATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDG-YENQM-----MVQ-WFKLHDGTVFVKKGHDEEPL  208 (469)
Q Consensus       136 ~~~~~~~ip~~~~l~~~v~l~~~~~~~dv~~d~~l~k~il~~G~g-~~~p~-----~V~-~~~l~~g~~~d~~~~~~~~p  208 (469)
                           +.||++++|.|+|+++          |++|+|+|+++|.| ..+|+     .|| .|.+.++ +|+++    .-.
T Consensus        67 -----p~ip~~a~l~fe~el~----------Dg~iiKriir~G~gd~~~P~~g~~V~v~~~G~~~~~-~f~~~----~~~  126 (397)
T KOG0543|consen   67 -----PKIPSNATLLFEVELL----------DGGIIKRIIREGEGDYSRPNKGAVVKVHLEGELEDG-VFDQR----ELR  126 (397)
T ss_pred             -----CCCCCCcceeeeeccc----------CCceEEeeeecCCCCCCCCCCCcEEEEEEEEEECCc-ceecc----ccc
Confidence                 6799999999999997          78999999999999 67888     455 8999888 77765    455


Q ss_pred             EEEEcCC-CccchhHHHHHhccccCcEEEEEEcCCCccCCCCCcccccCCCCCceEEEEEEEeeee-ecccccCCChHHH
Q 036950          209 FEFKIDE-EQVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFI-KEKESWDMNTQEK  286 (469)
Q Consensus       209 ~~~~lG~-~~v~~gle~~L~~m~~Ge~~~~~i~~~~~yg~~~~~~~~~~ip~~~~l~f~vel~~~~-~~~~~~~l~~~e~  286 (469)
                      |.|.+|+ ..+|.||+.||++|++||++.|+|+|+|+||+.+...  +.||||++|.|+|+|++|. +....|.|..+|+
T Consensus       127 fe~~~Ge~~~vi~Gle~al~~M~~GE~a~v~i~~~YayG~~~~~~--p~IPPnA~l~yEVeL~~f~~~~~~s~~~~~~e~  204 (397)
T KOG0543|consen  127 FEFGEGEDIDVIEGLEIALRMMKVGEVALVTIDPKYAYGEEGGEP--PLIPPNATLLYEVELLDFELKEDESWKMFAEER  204 (397)
T ss_pred             eEEecCCccchhHHHHHHHHhcCccceEEEEeCcccccCCCCCCC--CCCCCCceEEEEEEEEeeecCcccccccchHHH
Confidence            8999998 5999999999999999999999999999999655553  8999999999999999999 7889999999999


Q ss_pred             HHHhhhcHHHHHHHHhcCCHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHhHhHHHHHHHHhhCHHHHHHHHHHHH
Q 036950          287 IEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEYKQAEKLCSKVL  366 (469)
Q Consensus       287 ~~~a~~~k~~Gn~~fk~~~~~~A~~~Y~~al~~~~~~~~~~~e~~~~~~~l~~~~~~N~a~~~~kl~~~~~ai~~~~~al  366 (469)
                      ++.|.+.|+.||.+||.|+|..|...|.+|+.+++++...++++.+....++..||+|+|+||+|+++|..|+..|++||
T Consensus       205 l~~A~~~ke~Gn~~fK~gk~~~A~~~Yerav~~l~~~~~~~~ee~~~~~~~k~~~~lNlA~c~lKl~~~~~Ai~~c~kvL  284 (397)
T KOG0543|consen  205 LEAADRKKERGNVLFKEGKFKLAKKRYERAVSFLEYRRSFDEEEQKKAEALKLACHLNLAACYLKLKEYKEAIESCNKVL  284 (397)
T ss_pred             HHHHHHHHHhhhHHHhhchHHHHHHHHHHHHHHhhccccCCHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhc-----------------------HHHHHHHHhhCCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhc
Q 036950          367 ELD-----------------------KLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKL  423 (469)
Q Consensus       367 ~~d-----------------------~~~~~~al~l~p~~~~~~~~~~~~~l~~~~~~~~~~~~~e~~~~~~mf~~~~~~  423 (469)
                      +++                       +.+|++|++++|+|+     +|+.+|.+|++++++++.+++++|++||+++...
T Consensus       285 e~~~~N~KALyRrG~A~l~~~e~~~A~~df~ka~k~~P~Nk-----a~~~el~~l~~k~~~~~~kekk~y~~mF~k~~~~  359 (397)
T KOG0543|consen  285 ELDPNNVKALYRRGQALLALGEYDLARDDFQKALKLEPSNK-----AARAELIKLKQKIREYEEKEKKMYANMFAKLAEE  359 (397)
T ss_pred             hcCCCchhHHHHHHHHHHhhccHHHHHHHHHHHHHhCCCcH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Confidence            999                       789999999999999     9999999999999999999999999999998876


Q ss_pred             hhhhhh
Q 036950          424 EQAKSA  429 (469)
Q Consensus       424 ~~~~~~  429 (469)
                      ..+...
T Consensus       360 ~~k~~s  365 (397)
T KOG0543|consen  360 SAKTKS  365 (397)
T ss_pred             cccccc
Confidence            554433



>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
3jym_A377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-110
3jxv_A356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 1e-106
3jxv_A356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-26
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 3e-37
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 3e-36
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 5e-32
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 2e-30
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 7e-23
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 3e-18
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 2e-16
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 3e-11
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 3e-11
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 3e-11
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 3e-11
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 3e-10
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 1e-09
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 7e-10
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 1e-09
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 8e-10
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 1e-09
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 9e-09
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 2e-08
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 3e-08
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 5e-06
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 3e-04
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 1e-07
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 4e-07
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 9e-07
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 1e-06
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 2e-06
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 2e-06
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 2e-06
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 5e-06
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 5e-06
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 5e-06
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 5e-06
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 5e-06
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 6e-06
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 6e-06
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 7e-06
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 8e-06
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 5e-05
2fbn_A198 Plasmodium Falciparum Putative Fk506-Binding Protei 9e-06
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 9e-06
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 9e-06
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 1e-05
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 2e-05
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 1e-05
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 2e-04
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-05
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-05
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-05
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-05
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-05
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-05
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-05
2pbc_A102 Fk506-Binding Protein 2 Length = 102 2e-05
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 3e-05
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 4e-05
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 3e-05
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 4e-05
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 5e-05
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 4e-05
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 6e-05
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 4e-05
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 5e-05
2jwx_A157 Solution Structure Of The N-Terminal Domain Of Huma 8e-05
2ki3_A126 Structural And Biochemical Characterization Of Fk50 8e-05
2f2d_A121 Solution Structure Of The Fk506-Binding Domain Of H 1e-04
2awg_A118 Structure Of The Ppiase Domain Of The Human Fk506-B 1e-04
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 4e-04
2d9f_A135 Solution Structure Of Ruh-047, An Fkbp Domain From 5e-04
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 6e-04
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure

Iteration: 1

Score = 393 bits (1010), Expect = e-110, Method: Compositional matrix adjust. Identities = 205/286 (71%), Positives = 226/286 (79%), Gaps = 7/286 (2%) Query: 1 MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVE 60 MKKGENA+FTIPPELAYGESGSPPTIP NA LQFDVELL WTSV+DI KDGGIFKKIL E Sbjct: 93 MKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSVRDIAKDGGIFKKILKE 152 Query: 61 GKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVL 120 G KWENPKD DEVFVKYE RLEDGT++SKS+GVEFTV DG+ C ALAKAVKTMKKGEKVL Sbjct: 153 GDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVL 212 Query: 121 LTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSXXXXXXXXXXXXXXEGDG 180 L VKPQY FG+ GRPA G+ AVP NA+L I LE+VSWKTV+ E +G Sbjct: 213 LAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEG 272 Query: 181 YE--NQMMVQWF----KLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEV 234 YE N+ V KL DGTVF+KKGHDE+ FEFK DEE VI+GLDRAV MKKGEV Sbjct: 273 YERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEV 332 Query: 235 ALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKESWD 280 ALVTI PEYA+GS S K+ AIVP NST+ YEVELVSF+K+KESWD Sbjct: 333 ALVTIPPEYAYGSTES-KQDAIVPPNSTVIYEVELVSFVKDKESWD 377
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 Back     alignment and structure
>pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|2D9F|A Chain A, Solution Structure Of Ruh-047, An Fkbp Domain From Human Cdna Length = 135 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-101
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-51
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-97
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 6e-27
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 7e-18
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 8e-72
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-20
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-62
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-21
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 5e-06
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-50
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 4e-50
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 3e-23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-43
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-35
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 7e-28
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 3e-27
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 1e-19
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 2e-26
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 3e-26
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 2e-18
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 7e-26
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 6e-23
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 2e-16
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 8e-26
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 7e-24
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 4e-18
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 2e-22
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 8e-21
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 8e-18
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 1e-21
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 2e-19
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 7e-17
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 2e-21
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 4e-19
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 1e-15
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-20
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 1e-20
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 9e-17
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 5e-14
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 2e-20
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 1e-17
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 4e-12
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-20
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 1e-18
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-16
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 4e-20
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 3e-19
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-14
2ppn_A107 FK506-binding protein 1A; high resolution protein 1e-19
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-19
2ppn_A107 FK506-binding protein 1A; high resolution protein 6e-15
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 3e-19
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 3e-19
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 4e-15
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-18
1jvw_A167 Macrophage infectivity potentiator; chagas disease 2e-12
1jvw_A167 Macrophage infectivity potentiator; chagas disease 3e-08
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 2e-18
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 6e-18
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 4e-13
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 7e-17
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 1e-14
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 1e-08
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 8e-16
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 8e-16
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 4e-09
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 3e-15
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 1e-13
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 1e-09
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 3e-15
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 5e-15
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 5e-08
3q49_B137 STIP1 homology and U box-containing protein 1; E3 8e-14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 6e-13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-13
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 7e-13
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 1e-08
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 5e-06
1fd9_A213 Protein (macrophage infectivity potentiator prote; 2e-12
1fd9_A213 Protein (macrophage infectivity potentiator prote; 6e-09
1fd9_A213 Protein (macrophage infectivity potentiator prote; 3e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-12
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-11
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 3e-11
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 2e-08
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 8e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 5e-10
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-09
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-06
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-08
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-08
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-05
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-05
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 7e-08
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 4e-06
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 8e-08
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 4e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-06
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 3e-07
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 3e-07
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 5e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-07
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 1e-06
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 4e-06
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 1e-05
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 2e-04
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 2e-05
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 4e-05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 6e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 9e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-04
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 1e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-04
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
 Score =  305 bits (782), Expect = e-101
 Identities = 208/281 (74%), Positives = 233/281 (82%), Gaps = 7/281 (2%)

Query: 1   MKKGENAVFTIPPELAYGESGSPPTIPPNAMLQFDVELLGWTSVKDICKDGGIFKKILVE 60
           MKKGENA+FTIPPELAYGESGSPPTIP NA LQFDVELL WTSV+DI KDGGIFKKIL E
Sbjct: 77  MKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSVRDIAKDGGIFKKILKE 136

Query: 61  GKKWENPKDLDEVFVKYEVRLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVL 120
           G KWENPKD DEVFVKYE RLEDGT++SKS+GVEFTV DG+ C ALAKAVKTMKKGEKVL
Sbjct: 137 GDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVL 196

Query: 121 LTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDG 180
           L VKPQY FG+ GRPA G+  AVP NA+L I LE+VSWKTV++I  DKK+LKK+LKE +G
Sbjct: 197 LAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEG 256

Query: 181 YE-----NQMMVQWF-KLHDGTVFVKKGHDEEPLFEFKIDEEQVIDGLDRAVKTMKKGEV 234
           YE       + V+   KL DGTVF+KKGHDE+  FEFK DEE VI+GLDRAV  MKKGEV
Sbjct: 257 YERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEV 316

Query: 235 ALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKE 275
           ALVTI PEYA+GS  S K+ AIVP NST+ YEVELVSF+K+
Sbjct: 317 ALVTIPPEYAYGSTES-KQDAIVPPNSTVIYEVELVSFVKD 356


>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 100.0
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 100.0
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 100.0
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 100.0
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 100.0
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 100.0
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.96
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.95
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.9
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.86
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.86
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.86
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.85
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.84
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.84
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.84
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.84
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.84
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.84
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.83
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.83
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.83
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.82
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.82
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.82
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.82
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.82
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.81
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.81
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.81
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.81
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.8
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.8
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.8
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.79
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.79
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.79
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.78
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.77
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.77
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.77
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.77
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.76
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.76
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.75
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.75
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.75
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.75
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.73
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.73
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.73
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.71
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.7
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.7
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.7
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.67
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.66
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.62
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.55
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.54
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.5
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.5
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.49
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.48
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.48
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.46
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.46
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.41
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.39
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.36
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.35
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.35
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.3
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.24
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.22
1w26_A432 Trigger factor, TF; chaperone, protein folding, ri 99.21
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.2
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.2
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.2
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.17
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.17
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.1
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.1
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.94
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.9
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.88
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.85
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.84
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.78
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.76
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.69
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.67
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.66
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.63
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.62
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.61
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.61
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.61
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.59
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.58
1w26_A432 Trigger factor, TF; chaperone, protein folding, ri 98.58
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.58
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.51
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.51
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.5
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.49
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.48
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.48
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.46
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.43
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.42
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.41
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.41
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.38
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.37
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.35
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.34
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.34
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.27
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.25
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.23
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 98.23
3k9i_A117 BH0479 protein; putative protein binding protein, 98.22
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.2
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.19
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.19
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.18
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.16
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.13
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.12
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.11
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.1
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.1
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.08
3u4t_A272 TPR repeat-containing protein; structural genomics 98.07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.04
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.03
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.03
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.02
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.02
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.01
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.01
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.98
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.98
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.97
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.96
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.95
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.95
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 97.93
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.91
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.9
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.9
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.9
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.89
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.88
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.88
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.88
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.87
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.87
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.86
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.85
3u4t_A272 TPR repeat-containing protein; structural genomics 97.84
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.83
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.81
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.79
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.79
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 97.79
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.79
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.77
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.77
3gty_X433 Trigger factor, TF; chaperone-client complex, cell 97.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.76
3k9i_A117 BH0479 protein; putative protein binding protein, 97.72
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.72
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.72
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.71
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.71
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.7
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.7
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.69
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 97.68
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.67
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.66
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.66
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.65
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.65
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.65
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.62
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.62
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.61
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.61
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.6
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.59
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.58
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.57
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.57
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.56
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.55
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.54
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 97.51
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 97.5
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.5
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.48
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.45
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.44
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.43
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.43
4g1t_A 472 Interferon-induced protein with tetratricopeptide 97.42
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.4
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.39
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.39
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 97.39
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.38
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.37
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.36
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.34
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.32
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.27
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.26
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.23
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.23
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.22
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.17
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.16
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.15
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.13
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.02
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.02
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.88
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.84
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 96.72
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.7
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.66
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.65
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.6
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.53
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.53
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.52
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 96.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 96.48
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.37
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 96.23
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 96.17
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.1
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 96.07
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 95.91
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 95.86
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 95.86
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 95.85
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 95.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 95.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.68
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.68
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 95.64
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.45
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 95.34
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.31
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.09
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 95.07
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 94.95
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 94.87
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.83
1klx_A138 Cysteine rich protein B; structural genomics, heli 94.74
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 94.7
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.29
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.94
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 93.56
3gty_X433 Trigger factor, TF; chaperone-client complex, cell 93.53
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 93.07
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 92.99
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.06
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 91.95
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 91.39
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 91.2
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 91.19
3mkr_B320 Coatomer subunit alpha; tetratricopeptide repeats 91.04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 90.97
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 90.44
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 90.37
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 90.21
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 89.68
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 89.11
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 89.08
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 88.85
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 87.05
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 87.0
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 86.69
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 86.66
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 86.48
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 86.06
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 85.45
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 84.62
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 84.55
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 83.12
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 82.9
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 82.36
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
Probab=100.00  E-value=2.8e-52  Score=432.47  Aligned_cols=362  Identities=34%  Similarity=0.602  Sum_probs=304.3

Q ss_pred             cccc--cCCceEEEEEecCCccCCCCCCCEEEEEEEEEecCCcEEecc----ccEEEEECCCccchhHHHHHhcccCCcE
Q 036950           45 KDIC--KDGGIFKKILVEGKKWENPKDLDEVFVKYEVRLEDGTLISKS----DGVEFTVGDGYFCAALAKAVKTMKKGEK  118 (469)
Q Consensus        45 ~dv~--~d~g~~~~i~~~G~g~~~~~~gd~V~i~y~~~~~~G~~~~~t----~~~~~~ig~~~~~~gle~aL~gmk~Ge~  118 (469)
                      .|++  +++|+.++++.+|+|...|..||.|+|||++++.||++|++|    .|+.|.+|.+++++||+++|.+|++|++
T Consensus        23 ~~~~~~~~~g~~~~~~~~G~g~~~~~~gd~v~v~y~~~~~~g~~~dss~~~~~p~~~~~g~~~~i~g~~~~l~~m~~Ge~  102 (457)
T 1kt0_A           23 EDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKRGEI  102 (457)
T ss_dssp             ----------CEEEC--------CCCBTCEEEEEEEEEC-----CBC------CEEEETTSTTSCHHHHHHHTTCCTTCE
T ss_pred             ccccCCCCCcEEEEEEECCCCCCCCCCCCEEEEEEEEEECCCCEEeccCCCCCCeEEEeCCcchhhHHHHHHhhCCCCCE
Confidence            4555  789999999999999555999999999999998899999987    6899999999999999999999999999


Q ss_pred             EEEEEcCCccccCCCCCCCCCCCCCCCCceEEEeEeeeeeccccccccchhhhhhhhhcCCCCCCCc-----eEE-EEEe
Q 036950          119 VLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLEMVSWKTVSDITKDKKVLKKILKEGDGYENQM-----MVQ-WFKL  192 (469)
Q Consensus       119 ~~~~ip~~~ayg~~~~~~~~~~~~ip~~~~l~~~v~l~~~~~~~dv~~d~~l~k~il~~G~g~~~p~-----~V~-~~~l  192 (469)
                      +.|.|||+++||..+.+     +.||++++++|+|+|++|.. .++..+++++++++++|.|...|.     +|+ .|++
T Consensus       103 ~~~~i~~~~~yg~~g~~-----~~i~~~~~l~~~v~l~~~~~-~~~~~dg~~~k~i~~~g~~~~~p~~g~~V~v~y~g~~  176 (457)
T 1kt0_A          103 CHLLCKPEYAYGSAGSL-----PKIPSNATLFFEIELLDFKG-EDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRC  176 (457)
T ss_dssp             EEEEECGGGTTTTTCBT-----TTBCTTCCEEEEEEEEEEEC-EETTSSSSEEEEEEECCBCSCCCCTTCEEEEEEEEEE
T ss_pred             EEEEEChHHhccccCCC-----CCCCCCCcEEEEEeeceeec-ccccCCcceEEEEEecCCCCCCCCCCCEEEEEEEEEe
Confidence            99999999999988764     56999999999999999977 467788899999999999987777     455 8888


Q ss_pred             cCCcEEEecCCCCCCcEEEEcCCC---ccchhHHHHHhccccCcEEEEEEcCCCccCCCCCcccccCCCCCceEEEEEEE
Q 036950          193 HDGTVFVKKGHDEEPLFEFKIDEE---QVIDGLDRAVKTMKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVEL  269 (469)
Q Consensus       193 ~~g~~~d~~~~~~~~p~~~~lG~~---~v~~gle~~L~~m~~Ge~~~~~i~~~~~yg~~~~~~~~~~ip~~~~l~f~vel  269 (469)
                       +|++||++      +++|.+|+|   .+++||+.||..|++||++.|.++|.++|+..|...  ..||+++.+.|.+.+
T Consensus       177 -~g~~f~~~------~~~f~~g~g~~~~v~~~~e~al~~~~~ge~~~l~i~P~~ay~~~g~~~--~~ip~~~~l~y~~~l  247 (457)
T 1kt0_A          177 -GGRMFDCR------DVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPK--FGIEPNAELIYEVTL  247 (457)
T ss_dssp             -TTEEEEEE------EEEEETTCGGGGTCCHHHHHHHTTCCBTCEEEEEECGGGTTCSSCBGG--GTBCTTCCEEEEEEE
T ss_pred             -CCeEEecC------ceEEEeCCCccccCChHHHHHHHhCCCCCEEEEEECcccccCCCCCcc--cCCCCCCEEEEEhhh
Confidence             89999974      699999977   589999999999999999999999999999988763  469999999999999


Q ss_pred             eeeeecccccCCChHHHHHHhhhcHHHHHHHHhcCCHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHhHhHHHHHH
Q 036950          270 VSFIKEKESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACK  349 (469)
Q Consensus       270 ~~~~~~~~~~~l~~~e~~~~a~~~k~~Gn~~fk~~~~~~A~~~Y~~al~~~~~~~~~~~e~~~~~~~l~~~~~~N~a~~~  349 (469)
                      .++.+....|.+..+++...+..+++.|+.+|+.|+|.+|+..|++|+.+.+....+.+++..+...+...+|+|+|.||
T Consensus       248 ~~~~~A~~~~~~~~~~~~~~a~~~~~~G~~~~~~g~~~~A~~~y~~Al~~~p~~~~~~~~~~~~~~~~~~~~~~nla~~~  327 (457)
T 1kt0_A          248 KSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCY  327 (457)
T ss_dssp             EEEECCCCGGGSCHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTCCSCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhcccCcchhhcCHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHhcccccCChHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999998887888888889999999999999999


Q ss_pred             HHhhCHHHHHHHHHHHHhhc-----------------------HHHHHHHHhhCCCCCCcchHHHHHHHHHHHHHHHHHH
Q 036950          350 LKLKEYKQAEKLCSKVLELD-----------------------KLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYN  406 (469)
Q Consensus       350 ~kl~~~~~ai~~~~~al~~d-----------------------~~~~~~al~l~p~~~~~~~~~~~~~l~~~~~~~~~~~  406 (469)
                      +++++|++|+.+|++||+++                       +.+|++|++++|++.     .+...+..+..++.++.
T Consensus       328 ~~~g~~~~A~~~~~~al~~~p~~~~a~~~~g~a~~~~g~~~~A~~~~~~al~l~P~~~-----~a~~~l~~~~~~~~~~~  402 (457)
T 1kt0_A          328 LKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNK-----AARLQISMCQKKAKEHN  402 (457)
T ss_dssp             HHTTCHHHHHHHHHHHHHHSTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTC---------CHHHHHHHHHHHHHHHH
T ss_pred             HHhcCHHHHHHHHHHHHhcCCccHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCH-----HHHHHHHHHHHHHHHHH
Confidence            99999999999999999998                       778999999999999     99999999999999999


Q ss_pred             HHHHHHHHHhhhhhhhchhh
Q 036950          407 KKDVQFYGNIFAKINKLEQA  426 (469)
Q Consensus       407 ~~e~~~~~~mf~~~~~~~~~  426 (469)
                      ++++++|++||+++...+..
T Consensus       403 ~a~~~~~~~~f~k~~~~d~~  422 (457)
T 1kt0_A          403 ERDRRIYANMFKKFAEQDAK  422 (457)
T ss_dssp             HHHHHHHHHC----------
T ss_pred             HHHHHHHHHHHhhhhhcccc
Confidence            99999999999998876654



>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 469
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 6e-21
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 8e-20
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 2e-18
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 1e-16
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 2e-09
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 4e-17
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 2e-13
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 5e-11
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 5e-17
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 8e-15
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-13
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-15
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-14
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 4e-09
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 6e-15
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 3e-14
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 8e-14
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 4e-11
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 7e-13
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 3e-10
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 3e-08
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-12
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 7e-12
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-09
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 3e-12
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 2e-11
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 4e-11
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 3e-12
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-09
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-08
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 7e-12
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 2e-10
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 5e-09
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-11
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-08
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 8e-11
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 3e-09
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 9e-09
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 3e-07
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 2e-05
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 0.004
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-04
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 0.004
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP51, C-terminal domain
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
 Score = 87.3 bits (215), Expect = 6e-21
 Identities = 55/172 (31%), Positives = 92/172 (53%), Gaps = 28/172 (16%)

Query: 276 KESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAK 335
           KESW+M+T+EK+E A   KE+G V FK GKY +A  +Y + V+++  +   S++E + ++
Sbjct: 1   KESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASE 60

Query: 336 VLKITCNLNNAACKLKLKEYKQAEKLCSKVLELD-----------------------KLD 372
              +   LN A C LKL+EY +A + C K L LD                       K D
Sbjct: 61  SFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGD 120

Query: 373 IKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQFYGNIFAKINKLE 424
            +K LE++P N        R++  + ++K +E+N++D + Y N+F K  + +
Sbjct: 121 FEKVLEVNPQNK-----AARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQD 167


>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.9
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.9
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.89
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.89
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.88
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.87
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.87
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.86
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.86
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.85
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.85
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.85
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.84
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.84
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.84
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.82
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.82
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.81
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.8
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.79
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.78
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.78
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.77
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.72
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.72
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.48
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.44
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.44
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.31
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.2
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.04
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.0
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.94
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.84
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 98.82
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.8
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.74
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.62
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.56
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.5
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.49
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.37
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.33
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.29
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.24
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.2
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.19
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.18
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.17
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.12
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.09
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.05
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.04
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.03
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.02
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.01
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.94
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.87
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.85
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.72
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.68
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 97.54
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.45
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 97.35
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.33
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.29
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.99
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.97
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.87
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 96.82
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.5
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.26
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 95.81
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 95.5
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 94.6
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 94.58
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 93.04
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 93.02
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 90.99
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 88.78
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 88.57
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 86.28
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 85.49
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 85.16
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 84.99
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP51, C-terminal domain
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
Probab=99.90  E-value=3.6e-23  Score=182.38  Aligned_cols=143  Identities=38%  Similarity=0.667  Sum_probs=137.0

Q ss_pred             ccccCCChHHHHHHhhhcHHHHHHHHhcCCHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHhHhHHHHHHHHhhCH
Q 036950          276 KESWDMNTQEKIEAAGKKKEEGNVLFKAGKYERASKRYEQAVNYIGYDSSFSDEEKQQAKVLKITCNLNNAACKLKLKEY  355 (469)
Q Consensus       276 ~~~~~l~~~e~~~~a~~~k~~Gn~~fk~~~~~~A~~~Y~~al~~~~~~~~~~~e~~~~~~~l~~~~~~N~a~~~~kl~~~  355 (469)
                      ++.|+|+..|+++.|..+++.||.+|+.|+|.+|+..|++||.+++.......+.......+...+|+|+|.||+++++|
T Consensus         1 ~e~~~m~~~E~~~~a~~~~e~G~~~~~~~~~~~A~~~Y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~Nla~~~~~l~~~   80 (168)
T d1kt1a1           1 KESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREY   80 (168)
T ss_dssp             CCGGGSCHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTCCSCCHHHHHHHHHHHHHHHHHHHHHHHHTTCH
T ss_pred             CCcccCCHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhhccchhhhhhcchhHHHHHHhHHHHHHHhhhc
Confidence            47899999999999999999999999999999999999999999999888888888899999999999999999999999


Q ss_pred             HHHHHHHHHHHhhc-----------------------HHHHHHHHhhCCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHH
Q 036950          356 KQAEKLCSKVLELD-----------------------KLDIKKALEIDPDNSLEAGWGVRMEYKLLKEKVREYNKKDVQF  412 (469)
Q Consensus       356 ~~ai~~~~~al~~d-----------------------~~~~~~al~l~p~~~~~~~~~~~~~l~~~~~~~~~~~~~e~~~  412 (469)
                      .+|+.+|++||+++                       +.+|+++++++|+|.     .+...+..+..++.++++++++.
T Consensus        81 ~~Ai~~~~~al~l~p~~~~a~~~~~~~~~~l~~~~~A~~~~~~al~l~P~n~-----~~~~~l~~~~~~~~~~~e~~kk~  155 (168)
T d1kt1a1          81 TKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNK-----AARLQIFMCQKKAKEHNERDRRT  155 (168)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCH-----HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccchhhhhhhhhcccchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCH-----HHHHHHHHHHHHHHhHHHHHHHH
Confidence            99999999999998                       789999999999999     99999999999999999999999


Q ss_pred             HHHhhhhhhhc
Q 036950          413 YGNIFAKINKL  423 (469)
Q Consensus       413 ~~~mf~~~~~~  423 (469)
                      |++||.+..+.
T Consensus       156 ~~~~f~~~~~~  166 (168)
T d1kt1a1         156 YANMFKKFAEQ  166 (168)
T ss_dssp             HHHHHHHHHTT
T ss_pred             HHHHHhhhhhc
Confidence            99999997754



>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure