Citrus Sinensis ID: 036991

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
FAQFGAGCFWGVELAFQRVVGVSKTEVGYSQGNVPDPNYRLVCSGTTNHVEVVRVQFDPQVCPYTNLLSVFWGRHDPTTLNRQGGDVGTQYRSGIYYYNETQARLARESMEAKQLEMKDQRKIVTEILPAKRFYRAEEYHQQYLEKGGGRGSKQSAEKGCDEPIRCYG
ccEEccccHHHHHHHccccccEEEEEcccccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHcccccccccccccccccccccEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHccccccccccccccccccccccc
FAQFGAGCFWGVELAFQRVVGVSKTEVGYSQGNVPDPNYRLVCSGTTNHVEVVRVQFDPQVCPYTNLLSVFWGRHDPTTLNRQGGDVGTQYRSGIYYYNETQARLARESMEAKQLEMKDQRKIVTEILPAKRFYRAEEYHQQYLEKGGGRGSKQSAEKGCDEPIRCYG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FAQFGAGCFWGVELAFQRVVGVSKTEVGYSQGNVPDPNYRLVCSGTTNHVEVVRVQFDPQVCPYTNLLSVFWGRHDPTTLNRQGGDVGTQYRSGIYYxxxxxxxxxxxxxxxxxxxxxDQRKIVTEILPAKRFYRAEEYHQQYLEKGGGRGSKQSAEKGCDEPIRCYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide methionine sulfoxide reductase A1 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRA family specifically reduces the MetSO S-enantiomer.confidentQ9FKF7
Peptide methionine sulfoxide reductase MsrA Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.probableA6VFD6
Peptide methionine sulfoxide reductase MsrA Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.probableQ39Z11

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.4.-With a disulfide as acceptor.probable
1.8.4.11Transferred entry: 1.8.4.11.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J89, chain A
Confidence level:very confident
Coverage over the Query: 1-168
View the alignment between query and template
View the model in PyMOL