Citrus Sinensis ID: 037019

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWDE
cHHHHHHHHHHcccccEEEEccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEEEcccccHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccccccc
cHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHccccccEEEEEcEccEccHHHHHHHHHcccEEEEEccccccccccHcccccccHHHHHHHHHHcccHHHHHHHHHHHHccEEccccccHHHHHHHHccccccccHHHHHHHHcccccccccccHHcccccccccHHHHccc
GLWEAMEVCQRLGLTKfigvsnfssKKIEALLAFstippsvnqvemnpawQQRQLREFCKSKSIIVNVfsplgavgscwgtnqVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFdwaltdhdydrinqipqhrmmprdeyitphgpfktLEELWDE
GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQipqhrmmprdeyitphgpfktleelwde
GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWDE
**WEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQ********YI***************
GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWDE
GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWDE
GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWDE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q9SQ64321 Non-functional NADPH-depe N/A no 0.994 0.542 0.563 1e-57
Q7G764321 Probable NAD(P)H-dependen yes no 0.994 0.542 0.534 1e-56
Q9SQ67321 NADPH-dependent codeinone N/A no 0.994 0.542 0.545 3e-54
Q7G765322 Probable NAD(P)H-dependen no no 0.994 0.540 0.505 1e-53
Q9SQ69321 NADPH-dependent codeinone N/A no 0.994 0.542 0.540 4e-53
B9VRJ2321 NADPH-dependent codeinone N/A no 0.994 0.542 0.534 3e-52
Q9SQ70321 NADPH-dependent codeinone N/A no 0.994 0.542 0.528 5e-52
Q9SQ68321 NADPH-dependent codeinone N/A no 0.994 0.542 0.528 7e-52
P26690315 NAD(P)H-dependent 6'-deox no no 0.948 0.526 0.556 6e-51
Q84TF0314 Aldo-keto reductase famil no no 0.982 0.547 0.436 9e-40
>sp|Q9SQ64|COR2_PAPSO Non-functional NADPH-dependent codeinone reductase 2 OS=Papaver somniferum GN=COR2 PE=1 SV=1 Back     alignment and function desciption
 Score =  221 bits (564), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 136/174 (78%)

Query: 2   LWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKS 61
           +W AME CQ LGLTK IGVSNFS KK+  L+A + IPP+VNQVEMNP WQQ++LR++CK+
Sbjct: 146 VWAAMEKCQMLGLTKSIGVSNFSCKKLHYLMATANIPPAVNQVEMNPIWQQQKLRDYCKT 205

Query: 62  KSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSF 121
            +I+V  +SPLGA G+ WG++ VM++E L QI+   G++VAQV LRW+ EQGA ++ KSF
Sbjct: 206 NNIMVTAYSPLGAKGTMWGSSGVMDSEVLNQISQVRGKSVAQVSLRWVYEQGASLLVKSF 265

Query: 122 NKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWDE 175
           N+ER+KENL IFDW L+  D   I+++PQ R+   D +++ +GPFK++EELWD+
Sbjct: 266 NEERMKENLKIFDWELSPEDLKNISELPQRRVSTGDPFVSINGPFKSVEELWDD 319

Papaver somniferum (taxid: 3469)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q7G764|NADO1_ORYSJ Probable NAD(P)H-dependent oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os10g0113000 PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ67|COR14_PAPSO NADPH-dependent codeinone reductase 1-4 OS=Papaver somniferum GN=COR1.4 PE=1 SV=2 Back     alignment and function description
>sp|Q7G765|NADO2_ORYSJ Probable NAD(P)H-dependent oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os10g0113100 PE=2 SV=1 Back     alignment and function description
>sp|Q9SQ69|COR12_PAPSO NADPH-dependent codeinone reductase 1-2 OS=Papaver somniferum GN=COR1.2 PE=1 SV=1 Back     alignment and function description
>sp|B9VRJ2|COR15_PAPSO NADPH-dependent codeinone reductase 1-5 OS=Papaver somniferum GN=COR1.5 PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ70|COR11_PAPSO NADPH-dependent codeinone reductase 1-1 OS=Papaver somniferum GN=COR1.1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ68|COR13_PAPSO NADPH-dependent codeinone reductase 1-3 OS=Papaver somniferum GN=COR1.3 PE=1 SV=1 Back     alignment and function description
>sp|P26690|6DCS_SOYBN NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|Q84TF0|AKRCA_ARATH Aldo-keto reductase family 4 member C10 OS=Arabidopsis thaliana GN=AKR4C10 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
255578325 320 aldo-keto reductase, putative [Ricinus c 0.994 0.543 0.643 6e-65
53988164 323 aldo/keto reductase [Fragaria x ananassa 0.994 0.538 0.609 1e-64
255561785 325 aldo-keto reductase, putative [Ricinus c 0.994 0.535 0.609 2e-58
255558364 325 aldo-keto reductase, putative [Ricinus c 1.0 0.538 0.571 2e-58
40781599 324 reductase 1 [Hydrangea macrophylla] gi|4 0.988 0.533 0.595 3e-58
147862768 321 hypothetical protein VITISV_013444 [Viti 0.994 0.542 0.609 4e-58
225424502 321 PREDICTED: probable NAD(P)H-dependent ox 0.994 0.542 0.603 7e-58
147862769 314 hypothetical protein VITISV_013445 [Viti 0.994 0.554 0.603 2e-57
225424504 314 PREDICTED: probable NAD(P)H-dependent ox 0.994 0.554 0.603 2e-57
194689226 314 unknown [Zea mays] gi|414865734|tpg|DAA4 0.994 0.554 0.574 6e-57
>gi|255578325|ref|XP_002530029.1| aldo-keto reductase, putative [Ricinus communis] gi|223530445|gb|EEF32329.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 142/174 (81%)

Query: 1   GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCK 60
            +W AME CQRLGLTK IGVSNFS KK++ +L+ +TIPPSVNQVE+NP WQQ++L EFC+
Sbjct: 144 AVWAAMEECQRLGLTKSIGVSNFSCKKLDIILSSATIPPSVNQVELNPVWQQKKLIEFCR 203

Query: 61  SKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKS 120
             SIIV  FSPLGA G+ WG+N VM+NE LK++A AHG+TVAQV LRWIIEQG  ++ KS
Sbjct: 204 RHSIIVTAFSPLGAKGANWGSNLVMDNEILKEVAKAHGKTVAQVALRWIIEQGTTLVVKS 263

Query: 121 FNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWD 174
           + KERLKEN++IFDW L+    D+INQIPQ R M ++E+++P GPFK++EELWD
Sbjct: 264 YKKERLKENMEIFDWTLSQEAIDKINQIPQQRFMLKEEFVSPDGPFKSIEELWD 317

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|53988164|gb|AAV28174.1| aldo/keto reductase [Fragaria x ananassa] Back     alignment and taxonomy information
>gi|255561785|ref|XP_002521902.1| aldo-keto reductase, putative [Ricinus communis] gi|223538940|gb|EEF40538.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255558364|ref|XP_002520209.1| aldo-keto reductase, putative [Ricinus communis] gi|223540701|gb|EEF42264.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|40781599|gb|AAR89809.1| reductase 1 [Hydrangea macrophylla] gi|40781603|gb|AAR89811.1| reductase 1 [Hydrangea macrophylla] Back     alignment and taxonomy information
>gi|147862768|emb|CAN83196.1| hypothetical protein VITISV_013444 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424502|ref|XP_002285211.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147862769|emb|CAN83197.1| hypothetical protein VITISV_013445 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424504|ref|XP_002285219.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|194689226|gb|ACF78697.1| unknown [Zea mays] gi|414865734|tpg|DAA44291.1| TPA: putative oxidoreductase, aldo/keto reductase family protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
UNIPROTKB|Q9SQ64321 COR2 "Non-functional NADPH-dep 0.994 0.542 0.563 7e-54
TAIR|locus:2025926320 AT1G59950 [Arabidopsis thalian 0.988 0.540 0.540 1.3e-50
UNIPROTKB|Q9SQ67321 COR1.4 "NADPH-dependent codein 0.994 0.542 0.545 5.8e-50
TAIR|locus:2025936326 AT1G59960 [Arabidopsis thalian 0.988 0.530 0.545 7.4e-50
UNIPROTKB|E7C196327 E7C196 "2-carbomethoxy-3-tropi 0.994 0.532 0.557 1.5e-49
UNIPROTKB|Q9SQ69321 COR1.2 "NADPH-dependent codein 0.994 0.542 0.540 1.4e-48
UNIPROTKB|B9VRJ2321 COR1.5 "NADPH-dependent codein 0.994 0.542 0.534 2.3e-48
UNIPROTKB|Q9SQ70321 COR1.1 "NADPH-dependent codein 0.994 0.542 0.528 3.7e-48
UNIPROTKB|Q9SQ68321 COR1.3 "NADPH-dependent codein 0.994 0.542 0.528 6e-48
TAIR|locus:2065639314 AKR4C10 "Aldo-keto reductase f 0.982 0.547 0.436 2.6e-38
UNIPROTKB|Q9SQ64 COR2 "Non-functional NADPH-dependent codeinone reductase 2" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
 Score = 557 (201.1 bits), Expect = 7.0e-54, P = 7.0e-54
 Identities = 98/174 (56%), Positives = 136/174 (78%)

Query:     2 LWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKS 61
             +W AME CQ LGLTK IGVSNFS KK+  L+A + IPP+VNQVEMNP WQQ++LR++CK+
Sbjct:   146 VWAAMEKCQMLGLTKSIGVSNFSCKKLHYLMATANIPPAVNQVEMNPIWQQQKLRDYCKT 205

Query:    62 KSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSF 121
              +I+V  +SPLGA G+ WG++ VM++E L QI+   G++VAQV LRW+ EQGA ++ KSF
Sbjct:   206 NNIMVTAYSPLGAKGTMWGSSGVMDSEVLNQISQVRGKSVAQVSLRWVYEQGASLLVKSF 265

Query:   122 NKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKTLEELWDE 175
             N+ER+KENL IFDW L+  D   I+++PQ R+   D +++ +GPFK++EELWD+
Sbjct:   266 NEERMKENLKIFDWELSPEDLKNISELPQRRVSTGDPFVSINGPFKSVEELWDD 319
GO:0047036 "codeinone reductase (NADPH) activity" evidence=IDA
TAIR|locus:2025926 AT1G59950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ67 COR1.4 "NADPH-dependent codeinone reductase 1-4" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
TAIR|locus:2025936 AT1G59960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E7C196 E7C196 "2-carbomethoxy-3-tropinone reductase" [Erythroxylum coca (taxid:289672)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ69 COR1.2 "NADPH-dependent codeinone reductase 1-2" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|B9VRJ2 COR1.5 "NADPH-dependent codeinone reductase 1-5" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ70 COR1.1 "NADPH-dependent codeinone reductase 1-1" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ68 COR1.3 "NADPH-dependent codeinone reductase 1-3" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
TAIR|locus:2065639 AKR4C10 "Aldo-keto reductase family 4 member C10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 1e-52
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 1e-44
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 4e-33
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 1e-28
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 6e-23
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 1e-19
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 1e-05
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
 Score =  168 bits (428), Expect = 1e-52
 Identities = 59/144 (40%), Positives = 89/144 (61%), Gaps = 6/144 (4%)

Query: 3   WEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSK 62
           W+A+E     GL + IGVSNF  + +E LL+ + + P+VNQ+E +P  +Q +L  FC+  
Sbjct: 123 WKALEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQPELLPFCQRH 182

Query: 63  SIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFN 122
            I V  +SPL   G      ++++N  L +IA  +G+T AQV LRW I++G IVI KS  
Sbjct: 183 GIAVEAYSPLAKGG------KLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTT 236

Query: 123 KERLKENLDIFDWALTDHDYDRIN 146
            ER++ENL  FD+ L++ D   I+
Sbjct: 237 PERIRENLAAFDFELSEEDMAAID 260

Length = 280
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 99.98
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 99.97
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 99.97
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 99.97
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 99.97
PRK10625346 tas putative aldo-keto reductase; Provisional 99.97
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 99.97
PRK10376290 putative oxidoreductase; Provisional 99.96
COG4989298 Predicted oxidoreductase [General function predict 99.96
PLN02587314 L-galactose dehydrogenase 99.96
PRK14863292 bifunctional regulator KidO; Provisional 99.96
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 99.91
KOG1576342 consensus Predicted oxidoreductase [Energy product 99.81
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.64
PRK10558 256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 95.72
PRK10128 267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 95.17
TIGR03239 249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 94.96
TIGR02311 249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 93.35
PRK12360281 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 86.28
PRK01045298 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate redu 84.99
COG1140513 NarY Nitrate reductase beta subunit [Energy produc 84.55
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 84.32
TIGR02026497 BchE magnesium-protoporphyrin IX monomethyl ester 82.8
TIGR00216280 ispH_lytB (E)-4-hydroxy-3-methyl-but-2-enyl pyroph 81.83
PF02401281 LYTB: LytB protein; InterPro: IPR003451 Terpenes a 80.04
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-36  Score=237.37  Aligned_cols=148  Identities=40%  Similarity=0.691  Sum_probs=140.4

Q ss_pred             CHHHHHHHHHHcCCccEEEecCCCHHHHHHHHHhCCCCceEeccccCcccccHHHHHHHHhCCCeEEEecCCCCCCCCCC
Q 037019            1 GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWG   80 (175)
Q Consensus         1 e~~~~l~~l~~~GkIr~iGvS~~~~~~i~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~gi~vi~~~~l~~~G~l~~   80 (175)
                      |+|++|++++++||||+||||||+++.++++++..++.|+++|++||++.++.+++++|+++||.+++|+||+. |-   
T Consensus       121 etw~alE~l~~~G~ir~IGVSNF~~~~L~~l~~~~~~~p~~NQIe~hp~~~q~el~~~~~~~gI~v~AysPL~~-g~---  196 (280)
T COG0656         121 ETWKALEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQPELLPFCQRHGIAVEAYSPLAK-GG---  196 (280)
T ss_pred             HHHHHHHHHHhcCCccEEEeeCCCHHHHHHHHHhcCCCCceEEEEeccCCCcHHHHHHHHHcCCEEEEECCccc-cc---
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999996 32   


Q ss_pred             CccccChHHHHHHHHHhCCCHHHHHHHHHHhCCcEEEecCCCHHHHHHhhcccCcccCHHHHHHHhccCCCCCC
Q 037019           81 TNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRMM  154 (175)
Q Consensus        81 ~~~~~~~~~l~~~a~~~g~~~~q~al~~~l~~~~~~i~G~~~~~~l~enl~a~~~~L~~~~~~~i~~~~~~~~~  154 (175)
                        .++..+.+.++|++||.|++|++|+|+++++.++||.+++++|+++|++++++.||++||+.|+++......
T Consensus       197 --~l~~~~~l~~Ia~k~g~t~AQv~L~W~i~~gv~~Ipks~~~~ri~eN~~~~~f~Ls~ed~~~i~~l~~~~~~  268 (280)
T COG0656         197 --KLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRENLAAFDFELSEEDMAAIDALDRGYGR  268 (280)
T ss_pred             --ccccChHHHHHHHHhCCCHHHHHHHHHHhCCcEEecCCCCHHHHHHHHhhhcCCCCHHHHHHHHhhccccCc
Confidence              166788999999999999999999999999999999999999999999999999999999999999987643

>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK12360 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK01045 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>TIGR00216 ispH_lytB (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase (IPP and DMAPP forming) Back     alignment and domain information
>PF02401 LYTB: LytB protein; InterPro: IPR003451 Terpenes are among the largest groups of natural products and include compounds such as vitamins, cholesterol and carotenoids Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 5e-50
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 1e-39
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 3e-37
3f7j_A276 B.Subtilis Yvgn Length = 276 3e-28
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 3e-28
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 6e-27
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 5e-26
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 7e-26
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 1e-25
3uzw_A346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 2e-25
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 2e-25
3bur_A326 Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- 2e-25
3cmf_A346 Crystal Structure Of Human Liver 5beta-Reductase (A 2e-25
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 1e-24
1hw6_A278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 3e-24
1a80_A277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 3e-24
1dla_A314 Novel Nadph-Binding Domain Revealed By The Crystal 3e-24
1eko_A315 Pig Aldose Reductase Complexed With Idd384 Inhibito 3e-24
1ah0_A316 Pig Aldose Reductase Complexed With Sorbinil Length 3e-24
1ihi_A323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 1e-23
1j96_A323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 1e-23
2ipj_A321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 1e-23
1xjb_A325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 1e-23
3uwe_A331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 1e-23
3c3u_A323 Crystal Structure Of Akr1c1 In Complex With Nadp An 2e-23
3b3d_A314 B.Subtilis Ytbe Length = 314 2e-23
1mrq_A323 Crystal Structure Of Human 20alpha-hsd In Ternary C 2e-23
1q5m_A322 Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh 2e-23
1q13_A323 Crystal Structure Of Rabbit 20alpha Hyroxysteroid D 2e-23
3gug_A323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 2e-23
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 2e-23
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 3e-23
3r43_A331 Akr1c3 Complexed With Mefenamic Acid Length = 331 3e-23
1s1p_A331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 3e-23
1ry0_A323 Structure Of Prostaglandin F Synthase With Prostagl 3e-23
1m9h_A278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 5e-23
2pdx_A316 Human Aldose Reductase Double Mutant S302r-C303d Co 8e-23
2fvl_A324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 8e-23
2pdq_A316 Human Aldose Reductase Mutant C303d Complexed With 8e-23
3q67_A316 Human Aldose Reductase C298s Mutant In Complex With 8e-23
2pdb_A316 Human Aldose Reductase Mutant F121p Complexed With 8e-23
1abn_A315 The Crystal Structure Of The Aldose Reductase Nadph 9e-23
2agt_A319 Aldose Reductase Mutant Leu 300 Pro Complexed With 9e-23
2pdf_A316 Human Aldose Reductase Mutant L300p Complexed With 9e-23
3lqg_A316 Human Aldose Reductase Mutant T113a Complexed With 9e-23
3ld5_A316 Human Aldose Reductase Mutant T113s Complexed With 9e-23
3rx2_A336 Crystal Structure Of Human Aldose Reductase Complex 9e-23
1pwl_A316 Crystal Structure Of Human Aldose Reductase Complex 9e-23
2pd5_A316 Human Aldose Reductase Mutant V47i Complexed With Z 9e-23
3onb_A315 Bond Breakage And Relocation Of A Covalently Bound 9e-23
2pdm_A316 Human Aldose Reductase Mutant S302r Complexed With 9e-23
1z3n_A319 Human Aldose Reductase In Complex With Nadp+ And Th 9e-23
2pdk_A316 Human Aldose Reductase Mutant L301m Complexed With 1e-22
2pdi_A316 Human Aldose Reductase Mutant L300a Complexed With 1e-22
2r24_A316 Human Aldose Reductase Structure Length = 316 1e-22
1el3_A316 Human Aldose Reductase Complexed With Idd384 Inhibi 1e-22
3lz5_A316 Human Aldose Reductase Mutant T113v Complexed With 1e-22
1ef3_A315 Fidarestat Bound To Human Aldose Reductase Length = 1e-22
2acu_A315 Tyrosine-48 Is The Proton Donor And Histidine-110 D 1e-22
3lbo_A316 Human Aldose Reductase Mutant T113c Complexed With 1e-22
2is7_A315 Crystal Structure Of Aldose Reductase Complexed Wit 1e-22
1c9w_A315 Cho Reductase With Nadp+ Length = 315 2e-22
2ipw_A315 Crystal Structure Of C298a W219y Aldose Reductase C 4e-22
1xgd_A315 Apo R268a Human Aldose Reductase Length = 315 7e-22
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 7e-22
3fjn_A323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 3e-21
3qkz_A316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 3e-21
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 3e-21
2ipf_A318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-21
2he5_A323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 4e-21
2ipg_A319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 4e-21
1frb_A315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 5e-21
3cv6_A323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 6e-21
3o3r_A316 Crystal Structure Of Akr1b14 In Complex With Nadp L 1e-20
2alr_A324 Aldehyde Reductase Length = 324 2e-20
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 3e-20
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 3e-20
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 3e-20
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 5e-20
1afs_A323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 3e-19
1lwi_A322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 4e-19
1ral_A308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 1e-18
3ln3_A324 Crystal Structure Of Putative Reductase (Np_038806. 2e-17
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 2e-17
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 2e-17
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 2e-17
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 2e-17
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 4e-17
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 5e-17
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 1e-15
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 1e-15
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure 
Iteration: 1

 Score =  193 bits (490), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 93/176 (52%), Positives = 130/176 (73%), Gaps = 10/176 (5%)
Query: 1   GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCK 60
           G+WE+ME   +LGLTK IGVSNFS KK+E LL+ +T+ P+VNQVEMN AWQQ++LREFC 
Sbjct: 146 GVWESMEESLKLGLTKAIGVSNFSVKKLENLLSVATVLPAVNQVEMNLAWQQKKLREFCN 205
Query: 61  SKSIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKS 120
           +  I++  FSP+   G+  G N+VM N+ LK+IADAHG++VAQ+ LRW+ EQG   + KS
Sbjct: 206 AHGIVLTAFSPVRK-GASRGPNEVMENDMLKEIADAHGKSVAQISLRWLYEQGVTFVPKS 264
Query: 121 FNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYITPHGPFKT-LEELWDE 175
           ++KER+ +NL IFDW+LT  D+++I QI Q+R++P        GP K  L +L+D+
Sbjct: 265 YDKERMNQNLRIFDWSLTKEDHEKIAQIKQNRLIP--------GPTKPGLNDLYDD 312
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 Back     alignment and structure
>pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 Back     alignment and structure
>pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 Back     alignment and structure
>pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 Back     alignment and structure
>pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 Back     alignment and structure
>pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 Back     alignment and structure
>pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 Back     alignment and structure
>pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 Back     alignment and structure
>pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 Back     alignment and structure
>pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 Back     alignment and structure
>pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 Back     alignment and structure
>pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 Back     alignment and structure
>pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 Back     alignment and structure
>pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 Back     alignment and structure
>pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 Back     alignment and structure
>pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 Back     alignment and structure
>pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 Back     alignment and structure
>pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 Back     alignment and structure
>pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 Back     alignment and structure
>pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 Back     alignment and structure
>pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 2e-91
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 4e-91
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 1e-83
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 3e-83
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 4e-73
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 7e-72
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 2e-69
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 3e-69
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 2e-68
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 9e-68
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 6e-67
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 8e-67
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 6e-64
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 5e-58
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 6e-58
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 3e-57
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 3e-57
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 7e-57
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 7e-57
4gie_A290 Prostaglandin F synthase; structural genomics, nia 2e-56
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 2e-56
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 5e-56
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 6e-56
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 3e-55
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 1e-51
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 2e-17
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 8e-17
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 1e-15
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 4e-14
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 9e-12
3erp_A353 Putative oxidoreductase; funded by the national in 4e-11
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 7e-10
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 8e-10
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 1e-09
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 4e-09
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 1e-08
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 7e-08
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
 Score =  268 bits (688), Expect = 2e-91
 Identities = 73/174 (41%), Positives = 116/174 (66%), Gaps = 1/174 (0%)

Query: 3   WEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSK 62
           W+AME     G  + IGVSNFS+KK+  LL  + +PP+VNQVE +P+W+Q +L+EFCKSK
Sbjct: 160 WKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSK 219

Query: 63  SIIVNVFSPLGAVGSCWGTNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFN 122
            + ++ +SPLG+ G+ W  + V+ N  L  +A+  G++ AQV LRW ++ G  V+ KS N
Sbjct: 220 GVHLSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTN 279

Query: 123 KERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYIT-PHGPFKTLEELWDE 175
           + R+KEN ++FDW++ D+ + +  +I Q R++     +     P+K++EELWD 
Sbjct: 280 EGRIKENFNVFDWSIPDYMFAKFAEIEQARLVTGSFLVHETLSPYKSIEELWDG 333
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 99.98
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 99.98
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 99.96
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.38
2q5c_A196 NTRC family transcriptional regulator; structural 86.23
3szu_A328 ISPH, 4-hydroxy-3-methylbut-2-ENYL diphosphate red 80.8
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=3.3e-39  Score=261.10  Aligned_cols=175  Identities=42%  Similarity=0.813  Sum_probs=162.7

Q ss_pred             CHHHHHHHHHHcCCccEEEecCCCHHHHHHHHHhCCCCceEeccccCcccccHHHHHHHHhCCCeEEEecCCCCCCCCCC
Q 037019            1 GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSCWG   80 (175)
Q Consensus         1 e~~~~l~~l~~~GkIr~iGvS~~~~~~i~~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~gi~vi~~~~l~~~G~l~~   80 (175)
                      |+|++|++|+++||||+||||||++++++++++.++++|+++|++||++.++.+++++|+++||++++|+||+++|..++
T Consensus       158 e~~~aL~~l~~~Gkir~iGvSn~~~~~l~~~~~~~~~~~~~~Q~~~~~~~~~~~l~~~~~~~gI~v~a~sPL~~g~~~~~  237 (335)
T 3h7u_A          158 STWKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVHLSAYSPLGSPGTTWL  237 (335)
T ss_dssp             HHHHHHHHHHHTTSBSSEEEESCCHHHHHHHHHHCSSCCSEEEEECBTTBCCHHHHHHHHHHTCEEEEESTTCCTTCTTS
T ss_pred             HHHHHHHHHHHcCCccEEEecCCCHHHHHHHHHhCCCCeEEEecccccccCCHHHHHHHHHCCCEEEEeccCcCCCCCCC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999987355555


Q ss_pred             CccccChHHHHHHHHHhCCCHHHHHHHHHHhCCcEEEecCCCHHHHHHhhcccCcccCHHHHHHHhccCCCCCCCCcccc
Q 037019           81 TNQVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRMMPRDEYI  160 (175)
Q Consensus        81 ~~~~~~~~~l~~~a~~~g~~~~q~al~~~l~~~~~~i~G~~~~~~l~enl~a~~~~L~~~~~~~i~~~~~~~~~~~~~~~  160 (175)
                      ....+..+.+.++|+++|+|++|+||+|+++++.++|+|+++++||++|+++++++|++++++.|+++.......+..|.
T Consensus       238 ~~~~~~~~~l~~iA~~~g~t~aqvaL~w~l~~~~~vI~g~~~~~~l~enl~a~~~~L~~e~~~~i~~l~~~~~~~~~~~~  317 (335)
T 3h7u_A          238 KSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGRIKENFNVFDWSIPDYMFAKFAEIEQARLVTGSFLV  317 (335)
T ss_dssp             CCCGGGCHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCSCHHHHHHHHCCSSCCCCHHHHHHGGGSCCCCSCCCGGGB
T ss_pred             CccccccHHHHHHHHHHCcCHHHHHHHHHHHCCCEEEeCCCCHHHHHHHHhhCCCCcCHHHHHHHHhHhhcCccccceec
Confidence            55666779999999999999999999999999999999999999999999999999999999999999998888888877


Q ss_pred             CCC-CCccchhhccCC
Q 037019          161 TPH-GPFKTLEELWDE  175 (175)
Q Consensus       161 ~~~-~~~~~~~~~~~~  175 (175)
                      ++. +||+++.++||+
T Consensus       318 ~~~~~p~~~~~~~~~~  333 (335)
T 3h7u_A          318 HETLSPYKSIEELWDG  333 (335)
T ss_dssp             CTTTSSBSSHHHHTTT
T ss_pred             cCCCCCcccccccccc
Confidence            655 899999999995
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3szu_A ISPH, 4-hydroxy-3-methylbut-2-ENYL diphosphate reductas; 3Fe-4S iron-sulfur cluster, conserved cysteine, IPP and DMAP production final STEP; HET: H6P; 1.40A {Escherichia coli} PDB: 3szl_A* 3f7t_A* 3szo_A* 3t0f_A* 3t0g_A* 3urk_A* 3utc_A* 3utd_A* 3uv3_A* 3uv6_A* 3uv7_A* 3uwm_A* 3ke8_A* 3ke9_A* 3kef_A* 3kel_A 3kem_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 1e-33
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 5e-32
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-29
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 7e-27
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 9e-27
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 1e-25
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-25
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 3e-24
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 3e-23
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 1e-21
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 1e-20
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 7e-19
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 5e-14
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 1e-12
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 2e-12
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 3e-08
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Aldose reductase (aldehyde reductase)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  119 bits (298), Expect = 1e-33
 Identities = 56/171 (32%), Positives = 91/171 (53%), Gaps = 7/171 (4%)

Query: 3   WEAMEVCQRLGLTKFIGVSNFSSKKIEALL--AFSTIPPSVNQVEMNPAWQQRQLREFCK 60
           W AME     GL K IG+SNF+  ++E +L        P+VNQ+E +P   Q +L ++C+
Sbjct: 142 WAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQ 201

Query: 61  SKSIIVNVFSPLGAVGSCWGTNQ---VMNNEALKQIADAHGETVAQVCLRWIIEQGAIVI 117
           SK I+V  +SPLG+    W   +   ++ +  +K IA  H +T AQV +R+ +++  +VI
Sbjct: 202 SKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVI 261

Query: 118 AKSFNKERLKENLDIFDWALTDHDYDRINQIPQ-HRMMPRDEYIT-PHGPF 166
            KS   ER+ EN  +FD+ L+  D   +    +  R+       +    PF
Sbjct: 262 PKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF 312
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 324 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 99.98
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 99.98
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 99.97
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 99.97
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 99.97
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 99.97
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 99.97
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 99.97
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 99.96
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 99.96
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 99.96
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 99.94
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 99.93
d1dxea_ 253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 96.62
d1izca_ 299 Macrophomate synthase {Macrophoma commelinae [TaxI 89.44
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 82.06
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: 3-alpha-hydroxysteroid dehydrogenase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=1.5e-32  Score=218.34  Aligned_cols=162  Identities=31%  Similarity=0.543  Sum_probs=145.2

Q ss_pred             CHHHHHHHHHHcCCccEEEecCCCHHHHHHHHHhCC--CCceEeccccCcccccHHHHHHHHhCCCeEEEecCCCCCCCC
Q 037019            1 GLWEAMEVCQRLGLTKFIGVSNFSSKKIEALLAFST--IPPSVNQVEMNPAWQQRQLREFCKSKSIIVNVFSPLGAVGSC   78 (175)
Q Consensus         1 e~~~~l~~l~~~GkIr~iGvS~~~~~~i~~~~~~~~--~~~~~~q~~~~~~~~~~~~~~~~~~~gi~vi~~~~l~~~G~l   78 (175)
                      |+|++|++|+++||||+||+||++.+.+.++++.+.  +.+.++|+.+++...+.+++++|+++||++++|+||++ |.+
T Consensus       146 e~~~~l~~l~~~Gkir~iGvSn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~i~i~a~spl~~-G~~  224 (319)
T d1afsa_         146 DTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGS-SRD  224 (319)
T ss_dssp             HHHHHHHHHHHTTSEEEEEEESCCHHHHHHHHTCTTCCSCCSEEEEECBTTBCCHHHHHHHHHHTCEEEEESTTSC-CCC
T ss_pred             HHHHHHHHHHHcCCEEEEeeccccHHHHHHHHHhhcccccccccccchhhccchHHHhHHHHHcCceecccccccc-ccc
Confidence            478999999999999999999999999999987765  44677888888888889999999999999999999999 987


Q ss_pred             CCCc-----cccChHHHHHHHHHhCCCHHHHHHHHHHhCCcEEEecCCCHHHHHHhhcccCcccCHHHHHHHhccCCCCC
Q 037019           79 WGTN-----QVMNNEALKQIADAHGETVAQVCLRWIIEQGAIVIAKSFNKERLKENLDIFDWALTDHDYDRINQIPQHRM  153 (175)
Q Consensus        79 ~~~~-----~~~~~~~l~~~a~~~g~~~~q~al~~~l~~~~~~i~G~~~~~~l~enl~a~~~~L~~~~~~~i~~~~~~~~  153 (175)
                      ....     .....+.+.++++++|+|++|+||+|+++++.++|+|+++++||++|+++.+++|+++|++.|+++.++.|
T Consensus       225 ~~~~~~~~~~~~~~~~~~~la~~~g~s~aqlAL~w~l~~~~~~I~G~~~~~~l~en~~a~~~~Ls~~e~~~L~~l~~~~r  304 (319)
T d1afsa_         225 KTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFR  304 (319)
T ss_dssp             TTTSCTTSCCGGGCHHHHHHHHHTTCCHHHHHHHHHHHTTCEEEECCSCHHHHHHHTTTTSCCCCHHHHHHHHTTCCCCC
T ss_pred             cCccCcCCchhhhHHHHHHHHHHHCCCHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHhCCCCCCHHHHHHHhCcCCCCC
Confidence            5432     24456889999999999999999999999998899999999999999999999999999999999999999


Q ss_pred             CCCccccCCC
Q 037019          154 MPRDEYITPH  163 (175)
Q Consensus       154 ~~~~~~~~~~  163 (175)
                      .....|+...
T Consensus       305 ~~~~~~~~~~  314 (319)
T d1afsa_         305 YNNAKYFDDH  314 (319)
T ss_dssp             SCCCGGGTTC
T ss_pred             CCCchhccCC
Confidence            8888887655
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure