Citrus Sinensis ID: 037056

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MKEIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELITEDRKVIFITSVDTGLY
cHHHHHHHHHccHHHHHHHcccccccHHHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHHHcHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccHHHHHcccccHHHHHHHHcccc
ccHHHHHHHccccHHHHHHHccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccHccccccccEEEEEEccccc
mkeieglfekdYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLnfmdpedlmlqdengntTFCFAAAVGAVDIANLMlkknpsllgirgtenipplYFAALFGQMGTASFLFHKSKKELITEDRKVIFITSVDTGLY
mkeieglfEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSkkelitedrkvifitsvdtgly
MKEIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELITEDRKVIFITSVDTGLY
******LFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELITEDRKVIFITSVD****
MKEIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELITEDRKVIFITSVDTGLY
MKEIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELITEDRKVIFITSVDTGLY
*KEIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELITEDRKVIFITSVDTGLY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELITEDRKVIFITSVDTGLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
O74881 1347 BTB/POZ domain-containing yes no 0.543 0.055 0.350 4e-05
Q8Q0U0360 Putative ankyrin repeat p yes no 0.702 0.269 0.336 0.0003
>sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 Back     alignment and function desciption
 Score = 46.6 bits (109), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 25  QTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPS 84
           +TVLH+A    + SFV+ LL     +  +  +E+G T    A  VG ++ A+L+L K+PS
Sbjct: 53  RTVLHIAVSENKNSFVRSLLQHKGIDVFVQDEESGYTALHRAIYVGNLEAASLLLSKDPS 112

Query: 85  L--LGIRGTENIPPLYF 99
              L I+  E + P  F
Sbjct: 113 FRSLRIKDKEGLSPFQF 129
Probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
356532642 590 PREDICTED: ankyrin repeat-containing pro 0.985 0.230 0.467 4e-25
356558266 584 PREDICTED: uncharacterized protein LOC10 0.985 0.232 0.437 2e-23
356498501 567 PREDICTED: uncharacterized protein LOC10 0.985 0.239 0.456 1e-22
147860696 891 hypothetical protein VITISV_011174 [Viti 0.963 0.149 0.444 1e-22
356558270199 PREDICTED: uncharacterized protein LOC10 0.992 0.688 0.422 2e-21
356532632 638 PREDICTED: uncharacterized protein LOC10 0.876 0.189 0.446 4e-20
356532648 739 PREDICTED: uncharacterized protein LOC10 0.876 0.163 0.409 6e-20
255590066 395 ankyrin repeat-containing protein, putat 0.891 0.311 0.403 6e-20
359472754 789 PREDICTED: ankyrin repeat-containing pro 0.876 0.153 0.409 7e-20
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.891 0.072 0.403 8e-20
>gi|356532642|ref|XP_003534880.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Glycine max] Back     alignment and taxonomy information
 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 87/137 (63%), Gaps = 1/137 (0%)

Query: 2   KEIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNT 61
           KE + + ++D  + + +AIT+G  TVLH+A GA   SFV+ LL  M  EDL LQD  GNT
Sbjct: 60  KEAKKILDQD-PALLNSAITKGWATVLHIAVGANHESFVEELLKLMSREDLELQDIKGNT 118

Query: 62  TFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELI 121
            FCFAAAVG V IA  M +KN SL  IRG E + PL+ A L G+   A +LF K+++ L 
Sbjct: 119 AFCFAAAVGNVHIAERMRRKNASLPMIRGGEGVTPLHLAVLQGRSEMAWYLFDKTRETLY 178

Query: 122 TEDRKVIFITSVDTGLY 138
            +D   +F+  V++ LY
Sbjct: 179 DDDWFQVFLICVNSRLY 195

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356558266|ref|XP_003547428.1| PREDICTED: uncharacterized protein LOC100814409 [Glycine max] Back     alignment and taxonomy information
>gi|356498501|ref|XP_003518089.1| PREDICTED: uncharacterized protein LOC100784675 [Glycine max] Back     alignment and taxonomy information
>gi|147860696|emb|CAN81449.1| hypothetical protein VITISV_011174 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356558270|ref|XP_003547430.1| PREDICTED: uncharacterized protein LOC100815473 [Glycine max] Back     alignment and taxonomy information
>gi|356532632|ref|XP_003534875.1| PREDICTED: uncharacterized protein LOC100808896 [Glycine max] Back     alignment and taxonomy information
>gi|356532648|ref|XP_003534883.1| PREDICTED: uncharacterized protein LOC100814269 [Glycine max] Back     alignment and taxonomy information
>gi|255590066|ref|XP_002535165.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223523865|gb|EEF27218.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
TAIR|locus:2165194282 AT5G35830 [Arabidopsis thalian 0.942 0.460 0.360 1.6e-17
TAIR|locus:2080240 574 AT3G54070 "AT3G54070" [Arabido 0.862 0.207 0.341 5.1e-14
POMBASE|SPCC330.11 1347 btb1 "BTB/POZ domain protein B 0.536 0.054 0.384 3.7e-06
TAIR|locus:2180228 625 AT5G04690 "AT5G04690" [Arabido 0.724 0.16 0.300 0.0001
POMBASE|SPAC6C3.08234 SPAC6C3.08 "proteasome regulat 0.652 0.384 0.333 0.00021
RGD|620156 843 Ank2 "ankyrin 2, neuronal" [Ra 0.637 0.104 0.307 0.00031
UNIPROTKB|F1S146 3896 ANK2 "Uncharacterized protein" 0.637 0.022 0.307 0.00035
TAIR|locus:2175413 669 AT5G04700 "AT5G04700" [Arabido 0.724 0.149 0.281 0.0006
UNIPROTKB|J9NTH2 2063 ANK2 "Uncharacterized protein" 0.637 0.042 0.307 0.00084
TAIR|locus:2165194 AT5G35830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 48/133 (36%), Positives = 74/133 (55%)

Query:     7 LFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFA 66
             + E+ Y   I   IT   +TVLH+A  AK   FV+ LL  ++  DL L++ +GNT  CFA
Sbjct:   107 IIEQKY--IIYQKITSKSETVLHIAVAAKHEGFVRNLLGSLESNDLALRNVDGNTALCFA 164

Query:    67 AAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSK-KELITEDR 125
             AA G V+IA ++++KN  L  IRG     P++ AALFG      +L+  ++ +E   E+ 
Sbjct:   165 AASGVVEIAKMLIEKNKDLPMIRGGGKTTPIHMAALFGHGEMVKYLYKNTRFREFNDEEF 224

Query:   126 KVIFITSVDTGLY 138
               +F   +   +Y
Sbjct:   225 VNLFHAVISADIY 237
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPCC330.11 btb1 "BTB/POZ domain protein Btb1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC6C3.08 SPAC6C3.08 "proteasome regulatory particle, gankyrin (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|620156 Ank2 "ankyrin 2, neuronal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S146 ANK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J9NTH2 ANK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030146001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (326 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 45.5 bits (108), Expect = 4e-07
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query: 25  QTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPS 84
           +T LH+A        V+ LL      D+  +D +G T    AA  G ++I  L+L+K   
Sbjct: 8   RTPLHLAASNGHLEVVKLLLENGA--DVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGAD 65

Query: 85  LLGIRGTENIPPLYFAALFGQMGTASFL 112
           +   R  +   PL+ AA  G +     L
Sbjct: 66  VN-ARDKDGNTPLHLAARNGNLDVVKLL 92

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.92
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.91
PHA02791284 ankyrin-like protein; Provisional 99.9
PHA02791 284 ankyrin-like protein; Provisional 99.9
PHA02875 413 ankyrin repeat protein; Provisional 99.88
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.88
PHA02875 413 ankyrin repeat protein; Provisional 99.88
PHA02874 434 ankyrin repeat protein; Provisional 99.88
PHA02874 434 ankyrin repeat protein; Provisional 99.87
PHA02878 477 ankyrin repeat protein; Provisional 99.87
PHA02741169 hypothetical protein; Provisional 99.86
PHA02859209 ankyrin repeat protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
PHA02946 446 ankyin-like protein; Provisional 99.86
KOG0508 615 consensus Ankyrin repeat protein [General function 99.86
PHA02859209 ankyrin repeat protein; Provisional 99.85
KOG0510 929 consensus Ankyrin repeat protein [General function 99.85
PHA03095 471 ankyrin-like protein; Provisional 99.85
PHA02884 300 ankyrin repeat protein; Provisional 99.84
PHA03100 480 ankyrin repeat protein; Provisional 99.84
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.84
PHA02878 477 ankyrin repeat protein; Provisional 99.84
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.83
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.83
PHA02798 489 ankyrin-like protein; Provisional 99.83
PHA03095 471 ankyrin-like protein; Provisional 99.83
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.83
PHA02741169 hypothetical protein; Provisional 99.83
PHA02989 494 ankyrin repeat protein; Provisional 99.82
PHA03100 480 ankyrin repeat protein; Provisional 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.82
PHA02876 682 ankyrin repeat protein; Provisional 99.82
PHA02798 489 ankyrin-like protein; Provisional 99.81
PHA02876 682 ankyrin repeat protein; Provisional 99.8
PHA02946 446 ankyin-like protein; Provisional 99.8
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.79
KOG0508 615 consensus Ankyrin repeat protein [General function 99.79
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.79
KOG0514452 consensus Ankyrin repeat protein [General function 99.79
PHA02795 437 ankyrin-like protein; Provisional 99.77
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.77
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.76
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.75
KOG0514452 consensus Ankyrin repeat protein [General function 99.75
PHA02917 661 ankyrin-like protein; Provisional 99.74
PHA02917 661 ankyrin-like protein; Provisional 99.74
PHA02884 300 ankyrin repeat protein; Provisional 99.74
PHA02989 494 ankyrin repeat protein; Provisional 99.74
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.73
PHA02795 437 ankyrin-like protein; Provisional 99.73
KOG0510 929 consensus Ankyrin repeat protein [General function 99.73
PHA02730 672 ankyrin-like protein; Provisional 99.72
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.71
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.7
PHA02730 672 ankyrin-like protein; Provisional 99.68
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.68
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.67
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.65
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.64
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.63
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.62
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.62
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.61
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.61
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.61
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.61
PHA02792 631 ankyrin-like protein; Provisional 99.6
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.6
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.59
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.57
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.54
PHA02792 631 ankyrin-like protein; Provisional 99.54
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.52
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.51
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.51
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.49
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.48
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.46
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.42
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.4
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.37
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.34
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.3
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.26
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.16
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.1
KOG0522 560 consensus Ankyrin repeat protein [General function 99.0
PF1360630 Ank_3: Ankyrin repeat 98.99
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.96
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.93
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.92
PF1360630 Ank_3: Ankyrin repeat 98.87
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.68
KOG0522 560 consensus Ankyrin repeat protein [General function 98.65
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.63
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.62
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.6
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.56
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.55
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.52
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.46
KOG2384223 consensus Major histocompatibility complex protein 98.37
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.35
KOG2384 223 consensus Major histocompatibility complex protein 98.26
KOG0511 516 consensus Ankyrin repeat protein [General function 98.23
KOG0511 516 consensus Ankyrin repeat protein [General function 98.23
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.18
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.91
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.89
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.32
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.26
KOG2505591 consensus Ankyrin repeat protein [General function 97.21
KOG2505591 consensus Ankyrin repeat protein [General function 97.07
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.96
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.26
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 86.21
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 84.94
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 81.84
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.97  E-value=1.6e-30  Score=153.55  Aligned_cols=132  Identities=18%  Similarity=0.164  Sum_probs=80.2

Q ss_pred             HHHHHHHhhchhhhhhhhhcCCccHHHHHHhcCChHHHHHHHhcCCCCCcccccCCCCcHHHHHHHcCcHHHHHHHHhhC
Q 037056            3 EIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKN   82 (138)
Q Consensus         3 ~~~~~l~~~~~~~~~~~~~~~g~t~lh~a~~~~~~~~~~~ll~~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll~~~   82 (138)
                      .+++++.+ .|.+++.+.|.+|+||||+||..|+.+++.+|+.. .+..++-+|..||||||+|+..|+-++++.|+.+.
T Consensus        18 kveel~~s-~~kSL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq-~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~   95 (226)
T KOG4412|consen   18 KVEELIQS-DPKSLNARDDQDGRTPLHWACSFGHVEIVYFLLSQ-PNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRS   95 (226)
T ss_pred             HHHHHHhc-ChhhhhccccccCCceeeeeeecCchhHHHHHHhc-CCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCC
Confidence            45566666 66666655555666666666666666666666642 24555556666666666666666666666666653


Q ss_pred             CCcccCCCCCCCCHHHHHHHcCChhHHHHHHhhch--HHHhhcCCchhhHHhhhcC
Q 037056           83 PSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSK--KELITEDRKVIFITSVDTG  136 (138)
Q Consensus        83 ~~~~~~~~~~~~tpl~~a~~~g~~~~~~~ll~~~~--~~~~~~~~~~l~~a~~~~~  136 (138)
                      +...+..++.|+|+||+|+..|..+++.+|++.|+  +..+..+.||+|.|+..+.
T Consensus        96 ~advna~tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGk  151 (226)
T KOG4412|consen   96 GADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGK  151 (226)
T ss_pred             CCCcceecCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccc
Confidence            23333566666666666666666666666666666  5555556666666655543

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-05
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 53/114 (46%), Gaps = 6/114 (5%)
Query: 25  QTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPS 84
           +T LH+A        V+ LL   +  D+   D NG T    AA++G ++I  ++LK    
Sbjct: 36  RTPLHMAAAVGHLEIVEVLLR--NGADVNAVDTNGTTPLHLAASLGHLEIVEVLLKYGAD 93
Query: 85  LLGIRGTENIPPLYFAALFGQMGTASFLFHKSKKELITEDR--KVIFITSVDTG 136
            +  +    I PLY AA +G +     L  K   ++  +D+  K  F  S+D G
Sbjct: 94  -VNAKDATGITPLYLAAYWGHLEIVEVLL-KHGADVNAQDKFGKTAFDISIDIG 145

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-05
2pnn_A273 Transient receptor potential cation channel subfa 7e-04
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
 Score = 39.8 bits (94), Expect = 8e-05
 Identities = 23/93 (24%), Positives = 35/93 (37%), Gaps = 7/93 (7%)

Query: 25  QTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKK--- 81
           QT LH+A    Q    + LL      D  L+D  GNT    A   G +    ++ +    
Sbjct: 46  QTPLHLAVITNQPEIAEALLGAG--CDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTT 103

Query: 82  --NPSLLGIRGTENIPPLYFAALFGQMGTASFL 112
               S+L          L+ A++ G +G    L
Sbjct: 104 PHLHSILKATNYNGHTCLHLASIHGYLGIVELL 136
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3hra_A201 Ankyrin repeat family protein; structural protein; 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.92
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.92
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.92
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.92
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.92
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.92
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.91
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.91
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.91
2rfa_A232 Transient receptor potential cation channel subfa 99.91
2etb_A256 Transient receptor potential cation channel subfam 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3hra_A201 Ankyrin repeat family protein; structural protein; 99.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.91
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.9
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.9
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.9
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.9
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.9
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.9
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.9
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.9
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.9
2etb_A256 Transient receptor potential cation channel subfam 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.89
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.89
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.89
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.89
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.89
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.89
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.89
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.89
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.89
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
2pnn_A273 Transient receptor potential cation channel subfa 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.88
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.88
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.88
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.88
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.88
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.88
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.88
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.87
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.87
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.87
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.87
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.86
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.86
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.86
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.85
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.85
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.84
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.84
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.84
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.83
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.79
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.78
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.66
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.96  E-value=9.8e-29  Score=149.46  Aligned_cols=129  Identities=20%  Similarity=0.290  Sum_probs=116.9

Q ss_pred             hHHHHHHHhhchhhhhhhhhcCCccHHHHHHhcCChHHHHHHHhcCCCCCcccccCCCCcHHHHHHHcCcHHHHHHHHhh
Q 037056            2 KEIEGLFEKDYRSTICAAITEGHQTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKK   81 (138)
Q Consensus         2 ~~~~~~l~~~~~~~~~~~~~~~g~t~lh~a~~~~~~~~~~~ll~~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll~~   81 (138)
                      +.|+.+|+.  +..++ ..|..|+||||+|+..++.+++++|++.  +++++.++..|.||||+|+..|+.+++++|++.
T Consensus        18 ~~v~~Ll~~--Gadvn-~~d~~g~t~l~~a~~~~~~~~~~~ll~~--gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~   92 (169)
T 4gpm_A           18 DRVKDLIEN--GADVN-ASDSDGRTPLHHAAENGHKEVVKLLISK--GADVNAKDSDGRTPLHHAAENGHKEVVKLLISK   92 (169)
T ss_dssp             HHHHHHHHT--TCCTT-CCCTTSCCHHHHHHHTTCHHHHHHHHHT--TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHT
T ss_pred             HHHHHHHHC--CCCCC-CcCCCCCCHHHHHHHcCCHHHHHHHHhc--ccchhhhccCCCCHHHHHHHcCCHHHHHHHHHC
Confidence            567888876  45566 4899999999999999999999999998  999999999999999999999999999999999


Q ss_pred             CCCcccCCCCCCCCHHHHHHHcCChhHHHHHHhhch--HHHhhcCCchhhHHhhhcC
Q 037056           82 NPSLLGIRGTENIPPLYFAALFGQMGTASFLFHKSK--KELITEDRKVIFITSVDTG  136 (138)
Q Consensus        82 ~~~~~~~~~~~~~tpl~~a~~~g~~~~~~~ll~~~~--~~~~~~~~~~l~~a~~~~~  136 (138)
                      ++++. .+|.+|+||||+|+..|+.+++++|++.|+  +..+..+.|||+.|+..+.
T Consensus        93 gadvn-~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~  148 (169)
T 4gpm_A           93 GADVN-AKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGN  148 (169)
T ss_dssp             TCCTT-CCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTC
T ss_pred             cCCCC-CCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCC
Confidence            97655 899999999999999999999999999998  7778889999999987654
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-04
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-04
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.001
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 45.0 bits (105), Expect = 5e-07
 Identities = 20/90 (22%), Positives = 33/90 (36%), Gaps = 3/90 (3%)

Query: 26  TVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSL 85
           T LHVA+       V+ LL         + +    T    AA  G  ++A  +L+     
Sbjct: 2   TPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK- 58

Query: 86  LGIRGTENIPPLYFAALFGQMGTASFLFHK 115
           +  +  ++  PL+ AA  G       L   
Sbjct: 59  VNAKAKDDQTPLHCAARIGHTNMVKLLLEN 88
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.88
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.88
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.87
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.86
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.86
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.86
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.84
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.83
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.82
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.82
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.8
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.78
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.77
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.76
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.76
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.75
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.72
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.72
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.47
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.92  E-value=7.1e-26  Score=128.10  Aligned_cols=105  Identities=19%  Similarity=0.216  Sum_probs=97.9

Q ss_pred             ccHHHHHHhcCChHHHHHHHhcCCCCCcccccCCCCcHHHHHHHcCcHHHHHHHHhhCCCcccCCCCCCCCHHHHHHHcC
Q 037056           25 QTVLHVATGAKQTSFVQRLLNFMDPEDLMLQDENGNTTFCFAAAVGAVDIANLMLKKNPSLLGIRGTENIPPLYFAALFG  104 (138)
Q Consensus        25 ~t~lh~a~~~~~~~~~~~ll~~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~tpl~~a~~~g  104 (138)
                      .|||++|+..|+.+++++|++.  +.+++.++..|+||+|+|+..++.++++++++.+++.. .+|..|+||||+|+..|
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~--g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~din-~~d~~g~tpLh~A~~~~   79 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAK--GEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADIN-APDKHHITPLLSAVYEG   79 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTT--TCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTTT-CCSSSCSCHHHHHHTTT
T ss_pred             ChHHHHHHHCCCHHHHHHHHHh--hhccccccccccccccccccccccccccccccccceee-ecccccccchhhhhhcC
Confidence            5799999999999999999998  99999999999999999999999999999999987655 88999999999999999


Q ss_pred             ChhHHHHHHhhch--HHHhhcCCchhhHHh
Q 037056          105 QMGTASFLFHKSK--KELITEDRKVIFITS  132 (138)
Q Consensus       105 ~~~~~~~ll~~~~--~~~~~~~~~~l~~a~  132 (138)
                      +.+++++|+++|+  +..+..|.||++.|.
T Consensus        80 ~~~~v~~Ll~~Gad~~~~d~~G~t~l~~a~  109 (118)
T d1myoa_          80 HVSCVKLLLSKGADKTVKGPDGLTALEATD  109 (118)
T ss_dssp             CCHHHHHHHTTCCCSSSSSSSTCCCCCTCS
T ss_pred             chhhhhhhhcccccceeeCCCCCCHHHHHh
Confidence            9999999999998  777888999998774
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure