Citrus Sinensis ID: 037064


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
STKEAFLEKFKKSVSKGFDPDIDLVKVGIANQTTMIKGETEEIGKLVEKTMMRKFGVENVNEHFISFNTICHAAQERQDAVYKLVEEKIDLILVVGGWNSSNTSSLQVIAEDRGIPSYWIDSEKRIGPGNKMAYKLMHGELVEKENWLPKGQITIGVTAGASTPDKAIEGVLKKVFEIKREEALQLP
ccHHHHHHHHHHccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHccccEEEEcccccccccccHHHHHHccHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHHcccccccccc
*TKEAFLEKFKKSVSKGFDPDIDLVKVGIANQTTMIKGETEEIGKLVEKTMMRKFGVENVNEHFISFNTICHAAQERQDAVYKLVEEKIDLILVVGGWNSSNTSSLQVIAEDRGIPSYWIDSEKRIGPGNKMAYKLMHGELVEKENWLPKGQITIGVTAGASTPDKAIEGVLKKVFEIKREEALQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
STKEAFLEKFKKSVSKGFDPDIDLVKVGIANQTTMIKGETEEIGKLVEKTMMRKFGVENVNEHFISFNTICHAAQERQDAVYKLVEEKIDLILVVGGWNSSNTSSLQVIAEDRGIPSYWIDSEKRIGPGNKMAYKLMHGELVEKENWLPKGQITIGVTAGASTPDKAIEGVLKKVFEIKREEALQLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). Is essential for chloroplast development.probableQ6AVG6
4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). Is essential for chloroplast development.probableQ94B35

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SZU, chain A
Confidence level:very confident
Coverage over the Query: 23-128,146-179
View the alignment between query and template
View the model in PyMOL
Template: 3HUU, chain A
Confidence level:probable
Coverage over the Query: 25-167
View the alignment between query and template
View the model in PyMOL