Citrus Sinensis ID: 037120

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49

MEKYLVSRESVPENPKRCNSSNRWKRSVVELNGRFESKYRHDLSALLMQSYSQIGAFPHLYHVDRVLCPTHEGIVNSQRSRAGDVAMIDHRRSFGKPGISALDFDCKGIYLVSATRSGCLTVHDFESLYYQCNGTLPGVGLKEDQSKHLLHIPLPQQLDAVRWNLANQDEVACASTRSNVVSIYDIGYISDEPVEVLKTRRSVTVVGSDVQKGLSDLAFSAVNTSRLIASDTHGVVNIWDRRVGVLPSLELSTGSHGTLNSIQLHAENQIIFAAGKHGSIYLWDLRGGRTSAPFHNHKEVCHLPLTSLKLASMLEKIGTLKAQSKIVSQEIHSIDLDPSCSYQLAFHLDDGWSGVLDVYNSRVSHVHCPPPAWLSDSNNSADQLHLRKPSWLSTNSIYAVGSSSDHGIHLLDFFPGSSSPSHVDYNEDIESLSERTKLKKENRFVPLSEGVTACVTHPLNNTIVAGTKNSSLLVVSQKQQCTSDSMLEQ

ccccccccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEcccccccccccEEEEEEcccccEEEEEEcccEEEEECccccEEEEcccccccccccccccEEEEEcccccEEEEEEccccccEEEEEECcccEEEEEEccccccccCEEEEEEEEEEEEccccccccEEEEEEEccccEEEEECccccEEEEEcccccCEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccEEEccccccccccEEEEEEccHHHccccccccccccccCEEEEECccccccEEEEEccccCEEEEEccccCEEECccccccccccccccccccccccccccccccEEEEECcccccEEEEECccccccccEEcccccccccccccccccccccccccccEEEEECcccccEEEEECcccEEEEEEccccccccccccc

*EKYL*********************SVVELNGRFESKYRHDLSALLMQSYSQIGAFPHLYHVDRVLCPTHEGIVNSQRSRAGDVAMIDHRRSFGKPGISALDFDCKGIYLVSATRSGCLTVHDFESLYYQCNGTLPGVGLKEDQSKHLLHIPLPQQLDAVRWNLANQDEVACASTRSNVVSIYDIGYISDEPVEVLKTRRSVTVVGSDVQKGLSDLAFSAVNTSRLIASDTHGVVNIWDRRVGVLPSLELSTGSHGTLNSIQLHAENQIIFAAGKHGSIYLWDLRGGRTSAPFHNHKEVCHLPLTSLKLASMLEKIGTLKAQSKIVSQEIHSIDLDPSCSYQLAFHLDDGWSGVLDVYNSRVSHVHCPPPAWLSDSNNSADQLHLRKPSWLSTNSIYAVGSSSDHGIHLLDFFPGSSSPSHVDYNEDIES************FVPLSEGVTACVTHPLNNTIVAGTKNSSLLVVSQKQ**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XYI, chain A
Confidence level:very confident
Coverage over the Query: 92-314,396-416,427-483
View the alignment between query and template
View the model in PyMOL

Template: 3GRE, chain A
Confidence level:very confident
Coverage over the Query: 93-313,336-416,427-435,448-476
View the alignment between query and template
View the model in PyMOL

Template: 2J04, chain B
Confidence level:very confident
Coverage over the Query: 94-327,355-412,447-481
View the alignment between query and template
View the model in PyMOL