Citrus Sinensis ID: 037142


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380---
SIASKTLEDKKAVVDHGAVPIFVKLLASPSDDIRMQSVWALGNIAAESPRFRDLVLGEAALIPLLTQLNNHENLSMKRIATWTLSNLCGGKPRPIFDQVRPCLPTLAQLVHSNDEHVMSNACWGLSLLCDGGKNDEIQAVIEAGVCPRLVKLLGHPSQSVLTQALHTVGNIARGDYSQTLYIINCGALPYLLGLLIDNHKTSIKNYACWIISNITAGNREQIQAVIDAGLIGPLVNLLQNAVFYIKKEAAWAISNATFGGTHEQIKYLEREGCIKPLCDLLLCPDPQIVTVCLKALENILKVGEAEKNTDTDIGDVNQYAQLVEEAKGLEKIENLQRHDNYEIHEKSAKILETYWCGRVVGPQPGLLYAGNEENEEEDALGVM
ccccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHccccccccccHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccHHccccc
SIASKTLEDKKAVVDHGAVPIFVKLLASPSDDIRMQSVWALGNIAAESPRFRDLVLGEAALIPLLTQLNNHENLSMKRIATWTLSNLCGGKPRPIFDQVRPCLPTLAQLVHSNDEHVMSNACWGLSLLCDGGKNDEIQAVIEAGVCPRLVKLLGHPSQSVLTQALHTVGNIARGDYSQTLYIINCGALPYLLGLLIDNHKTSIKNYACWIISNITAGNREQIQAVIDAGLIGPLVNLLQNAVFYIKKEAAWAISNATFGGTHEQIKYLEREGCIKPLCDLLLCPDPQIVTVCLKALENILKVGEAEKNTDTDIGDVNQYAQLVEEAKGLEKIENLQRHDNYEIHEKSAKILETYWCGRVVGPQP*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SIASKTLEDKKAVVDHGAVPIFVKLLASPSDDIRMQSVWALGNIAAESPRFRDLVLGEAALIPLLTQLNNHENLSMKRIATWTLSNLCGGKPRPIFDQVRPCLPTLAQLVHSNDEHVMSNACWGLSLLCDGGKNDEIQAVIEAGVCPRLVKLLGHPSQSVLTQALHTVGNIARGDYSQTLYIINCGALPYLLGLLIDNHKTSIKNYACWIISNITAGNREQIQAVIDAGLIGPLVNLLQNAVFYIKKEAAWAISNATFGGTHEQIKYLEREGCIKPLCDLLLCPDPQIVTVCLKALENILKVGEAEKNTDTDIGDVNQYAQLVEEAKGLEKIENLQRHDNYEIHEKSAKILETYWCGRVVGPQPGLLYAGNEENEEEDALGVM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Importin subunit alpha-7 Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.probableQ5RBV0
Importin subunit alpha-B Functions in nuclear protein import via a substrate-importin alpha-beta transport complex that passes though the nuclear pore complexes (NPC). Binds specifically and directly to substrates containing either a simple or bipartite NLS motif.probableQ76P29
Importin subunit alpha-7 Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.probableO60684

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JDH, chain A
Confidence level:very confident
Coverage over the Query: 2-288,300-382
View the alignment between query and template
View the model in PyMOL