Citrus Sinensis ID: 037149


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGINKTLERYQRCCFNPQDNSIERETQSWYQEATKLKAKYESLQRTQRHLLGEDLGPLSVKELQNLEKQLEGALALARQRKTQIMIEQVEDLRKKERQLGDINKQLRIKLETEGQSFKAIQDLWNSAAAGAGNSNFSVHPSHDSPMNCDPEPALQIGYLNYLPSEGSSVPKNTVGETNFIQGWVL
cccccccHHHccccccccccccccccccHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGINKTLERYQRCCFNPQD********SWYQEATKLKAKYESLQRTQRHLLGEDLGPLSVKELQNLEKQLEGALALARQRKTQIMIEQVEDLRKKERQLGDINKQLRIKLE*****************************************ALQIGYLNYL****************FIQGWVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGINKTLERYQRCCFNPQDNSIERETQSWYQEATKLKAKYESLQRTQRHLLGEDLGPLSxxxxxxxxxxxxxxxxxxxxxxxxIMIEQVEDLRKKERQLGDINKQLRIKLETEGQSFKAIQDLWNSAAAGAGNSNFSVHPSHDSPMNCDPEPALQIGYLNYLPSEGSSVPKNTVGETNFIQGWVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Agamous-like MADS-box protein AGL6 Probable transcription factor. Forms an heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.confidentP29386
MADS-box transcription factor 6 Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time.probableQ6EU39
Agamous-like MADS-box protein AGL9 homolog Probable transcription factor active in inflorescence development and floral organogenesis.probableO04067

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K6O, chain B
Confidence level:very confident
Coverage over the Query: 1-76
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 117-167
View the alignment between query and template
View the model in PyMOL
Template: 3HNW, chain A
Confidence level:probable
Coverage over the Query: 87-171
View the alignment between query and template
View the model in PyMOL