Citrus Sinensis ID: 037166


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MEKFVLQPSSSAHQLPLSGLTFAIKDIFDVDGHVTGFGNPDWARTHSAATSTAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPWAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTAGVIPMAQSFDTVGWFAWDPKILNRVGRVLLQLPDDASLVRPSQVIFAEDCLQLSSIPSDRITQGLVKSVEKLFGDCRECDSWRLCEGQSS
ccccccccccccccccccccEEEEEEcccccccccccccHHHHcccccccccHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccc
***************PLSGLTFAIKDIFDVDGHVTGFGNPDWARTHSAATSTAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPWAPDRVPGGSS***AVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTAGVIPMAQSFDTVGWFAWDPKILNRVGRVLLQLPDDASLVRPSQVIFAEDCLQLSSIPSDRITQGLVKSVEKLFGDCRECDSWRLCEGQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKFVLQPSSSAHQLPLSGLTFAIKDIFDVDGHVTGFGNPDWARTHSAATSTAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPWAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTAGVIPMAQSFDTVGWFAWDPKILNRVGRVLLQLPDDASLVRPSQVIFAEDCLQLSSIPSDRITQGLVKSVEKLFGDCRECDSWRLCEGQSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Amidase 1 Amidase involved in auxin biosynthesis. Converts indole-3-acetamide into indole-3-acetic acid. Can also use L-asparagine, oleamide and 1-naphtalene-acetamide as substrates, but not indole-3-acetonitrile or indole-3-acetyl-L-aspartic acid.probableQ9FR37

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A1K, chain A
Confidence level:very confident
Coverage over the Query: 10-229
View the alignment between query and template
View the model in PyMOL